• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens keratin 16 (KRT16), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu24939 Homo sapiens keratin 16 (KRT16), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu24939C Homo sapiens keratin 16 (KRT16), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_005557.3, 163659905
Length 1422 bp
Structure linear
Update Date 17-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens keratin 16 (KRT16), mRNA.
Product keratin, type I cytoskeletal 16
Comment

Summary: The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region of chromosome 17q12-q21. This keratin has been coexpressed with keratin 14 in a number of epithelial tissues, including esophagus, tongue, and hair follicles. Mutations in this gene are associated with type 1 pachyonychia congenita, non-epidermolytic palmoplantar keratoderma and unilateral palmoplantar verrucous nevus. [provided by RefSeq, Jul 2008].

RefSeq NP_005548.2
CDS 140..1561
Misc Feature(1)140..487
Misc Feature(2)140..487
Misc Feature(3)485..1420
Misc Feature(4)488..1411
Misc Feature(5)488..595
Misc Feature(6)596..649
Misc Feature(7)650..925
Misc Feature(8)<854..1120
Misc Feature(9)926..994
Misc Feature(10)995..1411
Misc Feature(11)1412..1558
Exon (1)1..670
Gene:KRT16
Gene Synonym:CK16; FNEPPK; K16; K1CP; KRT16A; NEPPK; PC1
Exon (2)671..753
Gene:KRT16
Gene Synonym:CK16; FNEPPK; K16; K1CP; KRT16A; NEPPK; PC1
Exon (3)754..910
Gene:KRT16
Gene Synonym:CK16; FNEPPK; K16; K1CP; KRT16A; NEPPK; PC1
Exon (4)911..1072
Gene:KRT16
Gene Synonym:CK16; FNEPPK; K16; K1CP; KRT16A; NEPPK; PC1
Exon (5)1073..1198
Gene:KRT16
Gene Synonym:CK16; FNEPPK; K16; K1CP; KRT16A; NEPPK; PC1
Exon (6)1199..1419
Gene:KRT16
Gene Synonym:CK16; FNEPPK; K16; K1CP; KRT16A; NEPPK; PC1
Exon (7)1420..1466
Gene:KRT16
Gene Synonym:CK16; FNEPPK; K16; K1CP; KRT16A; NEPPK; PC1
Exon (8)1467..1718
Gene:KRT16
Gene Synonym:CK16; FNEPPK; K16; K1CP; KRT16A; NEPPK; PC1
Translation MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSRFSSGG ACGLGGGYGGGFSSSSSFGSGFGGGYGGGLGAGFGGGLGAGFGGGFAGGDGLLVGSEKVT MQNLNDRLASYLDKVRALEEANADLEVKIRDWYQRQRPSEIKDYSPYFKTIEDLRNKIIA ATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLDELTLARTDLEMQ IEGLKEELAYLRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKN RRDAETWFLSKTEELNKEVASNSELVQSSRSEVTELRRVLQGLEIELQSQLSMKASLENS LEETKGRYCMQLSQIQGLIGSVEEQLAQLRCEMEQQSQEYQILLDVKTRLEQEIATYRRL LEGEDAHLSSQQASGQSYSSREVFTSSSSSSSRQTRPILKEQSSSSFSQGQSS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(61)-dbSNP:
complement(61)-t, adbSNP:113878014
complement(62)-g, cdbSNP:112338618
complement(67)-g, adbSNP:371495992
complement(76)-t, gdbSNP:200187418
164+, adbSNP:267607411
182+a, tdbSNP:267607409
complement(193)-t, gdbSNP:184161015
complement(194)-t, cdbSNP:373193001
complement(206)-t, cdbSNP:7226192
complement(217)-g, adbSNP:374940369
complement(221)-g, adbSNP:200236413
complement(260)-g, adbSNP:111383277
261+c, gdbSNP:1133106
complement(264)-t, gdbSNP:201289840
complement(274)-g, adbSNP:200661306
complement(277)-g, adbSNP:377057928
complement(291)-g, cdbSNP:372013961
complement(324)-t, cdbSNP:367990963
complement(325)-g, adbSNP:200450332
complement(337)-g, adbSNP:142717659
complement(338)-t, cdbSNP:62066634
complement(346)-t, g, adbSNP:112223718
complement(351)-g, cdbSNP:144088254
complement(366)-t, cdbSNP:374118704
complement(385)-g, adbSNP:377639708
complement(390)-t, cdbSNP:267604878
complement(438)-g, cdbSNP:140537366
complement(445)-c, adbSNP:151282702
448..459+, tggtggttttgcdbSNP:267607408
complement(475)-g, adbSNP:145042222
complement(487)-g, adbSNP:141262104
501+a, c, tdbSNP:28928894
504+a, cdbSNP:59349773
507+a, gdbSNP:121912477
510..512+, tcadbSNP:267607410
510+a, c, g, tdbSNP:58293603
complement(511)-g, adbSNP:200191520
512+a, gdbSNP:58608173
513+a, gdbSNP:60723330
518+c, tdbSNP:59856285
519+c, gdbSNP:57424749
522+a, tdbSNP:28928895
528..530+, cctdbSNP:58181827
complement(533)-t, gdbSNP:112109334
534+c, tdbSNP:60944949
complement(545)-g, adbSNP:200704257
complement(546)-t, cdbSNP:144180775
complement(554)-g, cdbSNP:139974035
complement(583)-t, cdbSNP:149934946
complement(586)-g, adbSNP:142288943
complement(608)-g, adbSNP:139139482
complement(664)-c, adbSNP:373125352
complement(678)-dbSNP:
complement(678)-g, adbSNP:142750223
complement(682)-g, adbSNP:372717053
complement(695)-t, cdbSNP:148632325
complement(697)-t, cdbSNP:144914208
complement(735)-g, adbSNP:144984779
complement(763)-dbSNP:
complement(763)-g, adbSNP:4796681
complement(766)-t, adbSNP:201633520
complement(771)-g, adbSNP:143374360
complement(776)-g, adbSNP:148173278
complement(783)-g, cdbSNP:147423442
complement(810)-t, cdbSNP:372759162
complement(812)-g, adbSNP:368180635
complement(813)-t, cdbSNP:142812826
complement(832)-g, adbSNP:370538173
complement(838)-g, adbSNP:138889840
complement(851)-t, cdbSNP:367929415
complement(862)-g, adbSNP:201618706
complement(863)-t, cdbSNP:377070153
complement(866)-t, cdbSNP:370377321
complement(885)-g, adbSNP:373296526
complement(904)-g, adbSNP:145075215
complement(936)-dbSNP:
complement(936)-t, gdbSNP:374969442
complement(940)-t, gdbSNP:200123727
complement(961)-c, adbSNP:141302209
complement(964)-t, adbSNP:141914758
complement(966)-g, adbSNP:372618636
complement(976)-g, adbSNP:368580381
complement(989)-g, adbSNP:202223973
complement(990)-t, cdbSNP:146562738
complement(1023)-t, gdbSNP:372328817
complement(1026)-g, adbSNP:145649029
complement(1030)-t, cdbSNP:368492370
complement(1040)-g, adbSNP:140428349
complement(1052)-c, adbSNP:200442443
complement(1055)-t, cdbSNP:112891689
complement(1064)-g, adbSNP:142668383
complement(1066)-t, cdbSNP:113500657
complement(1076)-dbSNP:
complement(1076)-t, cdbSNP:145560912
complement(1116)-c, adbSNP:201459436
complement(1128)-t, c, adbSNP:140407898
complement(1147)-g, adbSNP:147159853
complement(1148)-g, adbSNP:143438105
complement(1149)-t, cdbSNP:141910921
complement(1157)-g, adbSNP:370949280
complement(1166)-g, adbSNP:189042832
complement(1185)-g, adbSNP:267604877
1201+dbSNP:
1201+a, tdbSNP:59328451
complement(1210)-t, cdbSNP:375085095
complement(1235)-t, cdbSNP:372739869
complement(1236)-t, cdbSNP:150916635
complement(1247)-t, cdbSNP:201334428
complement(1291)-t, cdbSNP:376747202
complement(1292)-t, gdbSNP:373241507
complement(1307)-g, adbSNP:141569849
complement(1308)-g, cdbSNP:377349355
complement(1340)-g, cdbSNP:373125552
complement(1364)-g, adbSNP:148365727
complement(1365)-t, cdbSNP:368945986
complement(1391)-g, adbSNP:56259134
complement(1394)-g, adbSNP:138335461
complement(1395)-t, c, adbSNP:138288025
1409+, gdbSNP:267607407
complement(1423)-dbSNP:
complement(1423)-g, adbSNP:369631543
complement(1462)-g, adbSNP:367591548
complement(1482)-dbSNP:
complement(1482)-g, adbSNP:148936519
complement(1483)-t, cdbSNP:138720293
complement(1496)-t, gdbSNP:150387381
complement(1506)-t, cdbSNP:140398655
complement(1524)-t, adbSNP:62066633
complement(1584)-g, adbSNP:113024481
Gene SymbolKRT16
Gene SynonymCK16; FNEPPK; K16; K1CP; KRT16A; NEPPK; PC1
Chromosome17
Locus Map17q21.2
Title Keratin 16 regulates innate immunity in response to epidermal barrier breach .
Author Lessard JC, Pina-Paz S, Rotty JD, Hickerson RP, Kaspar RL, Balmain
Journal Proc. Natl. Acad. Sci. U.S.A. 110 (48), 19537-19542 (2013)
Title Identification of prognosis-relevant subgroups in patients with chemoresistant triple-negative breast cancer .
Author Yu KD, Zhu R, Zhan M, Rodriguez AA, Yang W, Wong S, Makris A, Lehmann BD, Chen X, Mayer I, Pietenpol JA, Shao ZM, Symmans WF and Chang JC.
Journal Clin. Cancer Res. 19 (10), 2723-2733 (2013)
Title A review of the clinical phenotype of 254 patients with genetically confirmed pachyonychia congenita .
Author Eliason MJ, Leachman SA, Feng BJ, Schwartz ME and Hansen CD.
Journal J. Am. Acad. Dermatol. 67 (4), 680-686 (2012)
Title Two novel de novo mutations of KRT6A and KRT16 genes in two Chinese pachyonychia congenita pedigrees with fissured tongue or diffuse plantar keratoderma .
Author Du ZF, Xu CM, Zhao Y, Liu WT, Chen XL, Chen CY, Fang H, Ke HP and Zhang XN.
Journal Eur J Dermatol 22 (4), 476-480 (2012)
Title Pachyonychia congenita patients with mutations in KRT6A have more extensive disease compared with patients who have mutations in KRT16 .
Author Spaunhurst KM, Hogendorf AM, Smith FJ, Lingala B, Schwartz ME, Cywinska-Bernas A, Zeman KJ and Tang JY.
Journal Br. J. Dermatol. 166 (4), 875-878 (2012)
Title cDNA cloning and bacterial expression of the human type I keratin 16 .
Author Paladini RD, Takahashi K, Gant TM and Coulombe PA.
Journal Biochem. Biophys. Res. Commun. 215 (2), 517-523 (1995)
Title Pachyonychia Congenita .
Author Smith,F.J.D., Hansen,C.D., Hull,P.R., Leachman,S.A., Kaspar,R.L., Schwartz,M.E., McLean,W.H.I., Milstone,L.M. and Sprecher,E.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes .
Author Rasmussen HH, van Damme J, Puype M, Gesser B, Celis JE and Vandekerckhove J.
Journal Electrophoresis 13 (12), 960-969 (1992)
Title A group of type I keratin genes on human chromosome 17: characterization and expression .
Author Rosenberg M, RayChaudhury A, Shows TB, Le Beau MM and Fuchs E.
Journal Mol. Cell. Biol. 8 (2), 722-736 (1988)
Title Three tightly linked genes encoding human type I keratins: conservation of sequence in the 5'-untranslated leader and 5'-upstream regions of coexpressed keratin genes .
Author RayChaudhury,A., Marchuk,D., Lindhurst,M. and Fuchs,E.
Journal Mol. Cell. Biol. 6 (2), 539-548 (1986)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.