• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens keratin 16 (KRT16), mRNA.


RefSeq Accession Definition Services Price Order
NM_005557 Homo sapiens keratin 16 (KRT16), mRNA. ORF Sequence $412.38
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_005557.3, 163659905
Length 1720 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens keratin 16 (KRT16), mRNA.
Product keratin, type I cytoskeletal 16
Comment

Summary: The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region of chromosome 17q12-q21. This keratin has been coexpressed with keratin 14 in a number of epithelial tissues, including esophagus, tongue, and hair follicles. Mutations in this gene are associated with type 1 pachyonychia congenita, non-epidermolytic palmoplantar keratoderma and unilateral palmoplantar verrucous nevus. [provided by RefSeq, Jul 2008].

RefSeq NP_005548.2
CDS 140..1561
Misc Feature(1)140..487
Misc Feature(2)140..487
Misc Feature(3)488..1420
Misc Feature(4)488..1411
Misc Feature(5)488..595
Misc Feature(6)596..649
Misc Feature(7)650..925
Misc Feature(8)926..994
Misc Feature(9)995..1411
Misc Feature(10)1412..1558
Exon (1)1..670
Gene:KRT16
Gene Synonym:CK16; FNEPPK; K16; K1CP; KRT16A; NEPPK
Exon (2)671..753
Gene:KRT16
Gene Synonym:CK16; FNEPPK; K16; K1CP; KRT16A; NEPPK
Exon (3)754..910
Gene:KRT16
Gene Synonym:CK16; FNEPPK; K16; K1CP; KRT16A; NEPPK
Exon (4)911..1072
Gene:KRT16
Gene Synonym:CK16; FNEPPK; K16; K1CP; KRT16A; NEPPK
Exon (5)1073..1198
Gene:KRT16
Gene Synonym:CK16; FNEPPK; K16; K1CP; KRT16A; NEPPK
Exon (6)1199..1419
Gene:KRT16
Gene Synonym:CK16; FNEPPK; K16; K1CP; KRT16A; NEPPK
Exon (7)1420..1466
Gene:KRT16
Gene Synonym:CK16; FNEPPK; K16; K1CP; KRT16A; NEPPK
Exon (8)1467..1718
Gene:KRT16
Gene Synonym:CK16; FNEPPK; K16; K1CP; KRT16A; NEPPK
Translation MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSRFSSGG ACGLGGGYGGGFSSSSSFGSGFGGGYGGGLGAGFGGGLGAGFGGGFAGGDGLLVGSEKVT MQNLNDRLASYLDKVRALEEANADLEVKIRDWYQRQRPSEIKDYSPYFKTIEDLRNKIIA ATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLDELTLARTDLEMQ IEGLKEELAYLRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKN RRDAETWFLSKTEELNKEVASNSELVQSSRSEVTELRRVLQGLEIELQSQLSMKASLENS LEETKGRYCMQLSQIQGLIGSVEEQLAQLRCEMEQQSQEYQILLDVKTRLEQEIATYRRL LEGEDAHLSSQQASGQSYSSREVFTSSSSSSSRQTRPILKEQSSSSFSQGQSS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(61)-dbSNP:
complement(61)-t, adbSNP:113878014
complement(62)-g, cdbSNP:112338618
complement(76)-t, gdbSNP:200187418
complement(127)-g, adbSNP:613517
complement(164)-, adbSNP:267607411
complement(180)-g, adbSNP:62074148
complement(180)-g, adbSNP:71362274
complement(182)-t, adbSNP:267607409
complement(193)-t, gdbSNP:184161015
complement(196)-t, cdbSNP:62076272
complement(206)-t, cdbSNP:7226192
complement(212)-t, cdbSNP:613074
complement(212)-t, cdbSNP:71362273
complement(221)-g, adbSNP:200236413
complement(247)-g, adbSNP:612713
complement(260)-g, adbSNP:111383277
complement(261)-g, cdbSNP:1133106
complement(264)-t, gdbSNP:201289840
complement(274)-g, adbSNP:200661306
complement(278)-c, adbSNP:76176752
complement(325)-g, adbSNP:200450332
complement(337)-g, adbSNP:142717659
complement(337)-c, adbSNP:1673797
complement(337)-c, adbSNP:16942131
complement(338)-t, cdbSNP:62066634
complement(346)-t, g, adbSNP:112223718
complement(351)-g, cdbSNP:144088254
complement(385)-g, adbSNP:138306349
complement(419)-c, adbSNP:612192
complement(421)-g, cdbSNP:150457351
complement(438)-g, cdbSNP:140537366
complement(445)-c, adbSNP:151282702
complement(448..459)-, tggtggttttgcdbSNP:267607408
complement(475)-g, adbSNP:145042222
complement(487)-g, adbSNP:141262104
complement(501)-t, c, adbSNP:28928894
complement(504)-c, adbSNP:59349773
complement(506)-t, gdbSNP:61736017
complement(507)-g, adbSNP:121912477
complement(510..512)-, tcadbSNP:267607410
complement(510)-t, g, c, adbSNP:58293603
complement(511)-g, adbSNP:200191520
complement(512)-t, cdbSNP:71234269
complement(512)-g, adbSNP:58608173
complement(512)-g, adbSNP:113773121
complement(513)-g, adbSNP:60723330
complement(514)-g, adbSNP:146543527
complement(518)-t, cdbSNP:59856285
complement(519)-g, cdbSNP:57424749
complement(522)-t, adbSNP:28928895
complement(528..530)-, cctdbSNP:58181827
complement(533)-t, gdbSNP:112109334
complement(534)-t, cdbSNP:60944949
complement(535)-t, cdbSNP:71234268
complement(545)-g, adbSNP:200704257
complement(546)-t, cdbSNP:144180775
complement(554)-g, cdbSNP:139974035
complement(568)-g, adbSNP:145062179
complement(583)-t, cdbSNP:149934946
complement(586)-g, adbSNP:142288943
complement(587)-g, adbSNP:71234267
complement(608)-g, adbSNP:139139482
complement(622)-t, gdbSNP:150752996
complement(631)-t, cdbSNP:111785545
complement(678)-dbSNP:
complement(678)-g, adbSNP:142750223
complement(695)-t, cdbSNP:148632325
complement(697)-t, cdbSNP:144914208
complement(735)-g, adbSNP:144984779
complement(757)-dbSNP:
complement(757)-g, cdbSNP:4611518
complement(763)-t, cdbSNP:2688009
complement(763)-g, adbSNP:4796681
complement(766)-t, adbSNP:201633520
complement(771)-g, adbSNP:143374360
complement(776)-g, adbSNP:148173278
complement(777)-g, adbSNP:28739464
complement(780)-t, adbSNP:4426403
complement(783)-g, cdbSNP:147423442
complement(813)-t, cdbSNP:142812826
complement(838)-g, adbSNP:138889840
complement(857)-g, cdbSNP:4474745
complement(862)-g, adbSNP:201618706
complement(904)-g, adbSNP:145075215
complement(905)-t, gdbSNP:78344587
complement(940)-dbSNP:
complement(940)-t, gdbSNP:200123727
complement(960)-t, cdbSNP:1682314
complement(961)-c, adbSNP:141302209
complement(964)-t, adbSNP:141914758
complement(989)-g, adbSNP:202223973
complement(990)-t, cdbSNP:146562738
complement(1002)-t, adbSNP:111227267
complement(1026)-g, adbSNP:145649029
complement(1040)-g, adbSNP:140428349
complement(1052)-c, adbSNP:200442443
complement(1055)-t, cdbSNP:112891689
complement(1064)-g, adbSNP:142668383
complement(1066)-t, cdbSNP:113500657
complement(1076)-dbSNP:
complement(1076)-t, cdbSNP:145560912
complement(1084)-g, cdbSNP:71234263
complement(1087)-t, gdbSNP:144369886
complement(1116)-c, adbSNP:201459436
complement(1127)-g, adbSNP:62068021
complement(1128)-t, c, adbSNP:140407898
complement(1142..1143)-tc, aadbSNP:71232517
complement(1147)-g, adbSNP:147159853
complement(1148)-g, adbSNP:143438105
complement(1149)-t, cdbSNP:141910921
complement(1166)-g, adbSNP:189042832
complement(1192)-g, adbSNP:71234262
complement(1201)-dbSNP:
complement(1201)-t, adbSNP:59328451
complement(1228)-g, adbSNP:673378
complement(1236)-t, cdbSNP:150916635
complement(1247)-t, cdbSNP:201334428
complement(1307)-g, adbSNP:141569849
complement(1364)-g, adbSNP:148365727
complement(1381)-g, adbSNP:146123655
complement(1391)-g, adbSNP:56259134
complement(1394)-g, adbSNP:138335461
complement(1395)-t, c, adbSNP:138288025
complement(1409)-, gdbSNP:267607407
complement(1482)-dbSNP:
complement(1482)-g, adbSNP:148936519
complement(1483)-t, cdbSNP:138720293
complement(1496)-t, gdbSNP:150387381
complement(1506)-t, cdbSNP:140398655
complement(1524)-t, adbSNP:62066633
complement(1584)-g, adbSNP:113024481
Gene SymbolKRT16
Gene SynonymCK16; FNEPPK; K16; K1CP; KRT16A; NEPPK
Chromosome17
Locus Map17q21.2
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_005557 Homo sapiens keratin 16 (KRT16), mRNA. Full Length $498.80
ORF Sequence $412.38
Title A review of the clinical phenotype of 254 patients with genetically confirmed pachyonychia congenita .
Author Eliason,M.J., Leachman,S.A., Feng,B.J., Schwartz,M.E. and Hansen,C.D.
Journal J. Am. Acad. Dermatol. 67 (4), 680-686 (2012)
Title Two novel de novo mutations of KRT6A and KRT16 genes in two Chinese pachyonychia congenita pedigrees with fissured tongue or diffuse plantar keratoderma .
Author Du,Z.F., Xu,C.M., Zhao,Y., Liu,W.T., Chen,X.L., Chen,C.Y., Fang,H., Ke,H.P. and Zhang,X.N.
Journal Eur J Dermatol 22 (4), 476-480 (2012)
Title Pachyonychia congenita patients with mutations in KRT6A have more extensive disease compared with patients who have mutations in KRT16 .
Author Spaunhurst,K.M., Hogendorf,A.M., Smith,F.J., Lingala,B., Schwartz,M.E., Cywinska-Bernas,A., Zeman,K.J. and Tang,J.Y.
Journal Br. J. Dermatol. 166 (4), 875-878 (2012)
Title Genotype-phenotype correlations among pachyonychia congenita patients with K16 mutations .
Author Fu,T., Leachman,S.A., Wilson,N.J., Smith,F.J., Schwartz,M.E. and Tang,J.Y.
Journal J. Invest. Dermatol. 131 (5), 1025-1028 (2011)
Title Trichohyalin is a potential major autoantigen in human alopecia areata .
Author Leung,M.C., Sutton,C.W., Fenton,D.A. and Tobin,D.J.
Journal J. Proteome Res. 9 (10), 5153-5163 (2010)
Title cDNA cloning and bacterial expression of the human type I keratin 16 .
Author Paladini,R.D., Takahashi,K., Gant,T.M. and Coulombe,P.A.
Journal Biochem. Biophys. Res. Commun. 215 (2), 517-523 (1995)
Title Control of keratin gene expression by vitamin A in tracheobronchial epithelial cells .
Author Huang,T.H., Ann,D.K., Zhang,Y.J., Chang,A.T., Crabb,J.W. and Wu,R.
Journal Am. J. Respir. Cell Mol. Biol. 10 (2), 192-201 (1994)
Title Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes .
Author Rasmussen,H.H., van Damme,J., Puype,M., Gesser,B., Celis,J.E. and Vandekerckhove,J.
Journal Electrophoresis 13 (12), 960-969 (1992)
Title A group of type I keratin genes on human chromosome 17: characterization and expression .
Author Rosenberg,M., RayChaudhury,A., Shows,T.B., Le Beau,M.M. and Fuchs,E.
Journal Mol. Cell. Biol. 8 (2), 722-736 (1988)
Title Three tightly linked genes encoding human type I keratins: conservation of sequence in the 5'-untranslated leader and 5'-upstream regions of coexpressed keratin genes .
Author RayChaudhury,A., Marchuk,D., Lindhurst,M. and Fuchs,E.
Journal Mol. Cell. Biol. 6 (2), 539-548 (1986)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878