• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens laminin, alpha 1 (LAMA1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu00326 Homo sapiens laminin, alpha 1 (LAMA1), mRNA. pcDNA3.1+-DYK On-demand $4749.00 40
OHu00326C Homo sapiens laminin, alpha 1 (LAMA1), mRNA. Customized vector On-demand $4749.00 40

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_005559.3, 329112585
Length 9228 bp
Structure linear
Update Date 15-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens laminin, alpha 1 (LAMA1), mRNA.
Product laminin subunit alpha-1 precursor
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AP005062.2, AP002409.3 and AP005210.2. On Apr 16, 2011 this sequence version replaced gi:38788415.


Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.

RefSeq NP_005550.2
CDS 95..9322
Misc Feature(1)158..898
Misc Feature(2)902..1045
Misc Feature(3)order(902..904,908..910,929..931,962..964,968..970,
Misc Feature(4)1145..1147
Misc Feature(5)1280..1444
Misc Feature(6)order(1283..1285,1289..1291,1319..1321,1373..1375,
Misc Feature(7)1451..1594
Misc Feature(8)order(1454..1456,1460..1462,1505..1507,1511..1513,
Misc Feature(9)1796..2215
Misc Feature(10)2315..2461
Misc Feature(11)order(2318..2320,2324..2326,2345..2347,2363..2365,
Misc Feature(12)2462..2626
Misc Feature(13)order(2465..2467,2471..2473,2510..2512,2540..2542,
Misc Feature(14)2636..2794
Misc Feature(15)order(2639..2641,2645..2647,2681..2683,2702..2704,
Misc Feature(16)2795..2941
Misc Feature(17)order(2798..2800,2804..2806,2834..2836,2855..2857,
Misc Feature(18)2942..3082
Misc Feature(19)order(2945..2947,2951..2953,2981..2983,2999..3001,
Misc Feature(20)3083..3220
Misc Feature(21)order(3086..3088,3092..3094,3113..3115,3134..3136,
Misc Feature(22)3221..3352
Misc Feature(23)order(3224..3226,3230..3232,3260..3262,3281..3283,
Misc Feature(24)3359..3535
Misc Feature(25)order(3362..3364,3368..3370,3398..3400,3446..3448,
Misc Feature(26)3746..4174
Misc Feature(27)4298..4414
Misc Feature(28)order(4301..4303,4307..4309,4328..4330,4349..4351,
Misc Feature(29)4448..4615
Misc Feature(30)order(4448..4450,4454..4456,4490..4492,4520..4522,
Misc Feature(31)4619..>4732
Misc Feature(32)order(4619..4621,4625..4627,4655..4657,4676..4678,
Misc Feature(33)4760..6442
Misc Feature(34)4793..5587
Misc Feature(35)4919..5617
Misc Feature(36)6125..6529
Misc Feature(37)6479..6928
Misc Feature(38)7013..7483
Misc Feature(39)7556..8053
Misc Feature(40)7694..7702
Misc Feature(41)8285..8695
Misc Feature(42)8768..9223
Exon (1)1..155
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (2)156..326
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (3)327..439
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (4)440..682
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (5)683..862
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (6)863..952
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (7)953..1070
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (8)1071..1249
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (9)1250..1355
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (10)1356..1516
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (11)1517..1657
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (12)1658..1831
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (13)1832..1933
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (14)1934..2145
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (15)2146..2257
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (16)2258..2368
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (17)2369..2496
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (18)2497..2583
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (19)2584..2795
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (20)2796..2902
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (21)2903..3083
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (22)3084..3220
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (23)3221..3457
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (24)3458..3601
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (25)3602..3781
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (26)3782..3967
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (27)3968..4095
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (28)4096..4216
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (29)4217..4354
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (30)4355..4476
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (31)4477..4563
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (32)4564..4757
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (33)4758..4900
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (34)4901..4990
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (35)4991..5102
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (36)5103..5262
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (37)5263..5473
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (38)5474..5590
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (39)5591..5754
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (40)5755..5890
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (41)5891..5984
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (42)5985..6101
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (43)6102..6284
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (44)6285..6439
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (45)6440..6583
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (46)6584..6717
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (47)6718..6868
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (48)6869..6993
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (49)6994..7144
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (50)7145..7289
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (51)7290..7431
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (52)7432..7546
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (53)7547..7720
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (54)7721..7872
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (55)7873..8058
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (56)8059..8188
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (57)8189..8301
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (58)8302..8491
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (59)8492..8650
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (60)8651..8804
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (61)8805..8938
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (62)8939..9161
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Exon (63)9162..9657
Gene:LAMA1
Gene Synonym:LAMA; S-LAM-alpha
Translation MRGGVLLVLLLCVAAQCRQRGLFPAILNLASNAHISTNATCGEKGPEMFCKLVEHVPGRP VRNPQCRICDGNSANPRERHPISHAIDGTNNWWQSPSIQNGREYHWVTITLDLRQVFQVA YVIIKAANAPRPGNWILERSLDGTTFSPWQYYAVSDSECLSRYNITPRRGPPTYRADDEV ICTSYYSRLVPLEHGEIHTSLINGRPSADDLSPKLLEFTSARYIRLRLQRIRTLNADLMT LSHREPKELDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDETTKKLQCQCEHNTCGES CNRCCPGYHQQPWRPGTVSSGNTCEACNCHNKAKDCYYDESVAKQKKSLNTAGQFRGGGV CINCLQNTMGINCETCIDGYYRPHKVSPYEDEPCRPCNCDPVGSLSSVCIKDDLHSDLHN GKQPGQCPCKEGYTGEKCDRCQLGYKDYPTCVSCGCNPVGSASDEPCTGPCVCKENVEGK ACDRCKPGFYNLKEKNPRGCSECFCFGVSDVCSSLSWPVGQVNSMSGWLVTDLISPRKIP SQQDALGGRHQVSINNTAVMQRLAPKYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETV DSNLMSHADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFQDFHSKRQIDRDQLM TVLANVTHLLIRANYNSAKMALYRLESVSLDIASSNAIDLVVAADVEHCECPQGYTGTSC ESCLSGYYRVDGILFGGICQPCECHGHAAECNVHGVCIACAHNTTGVHCEQCLPGFYGEP SRGTPGDCQPCACPLTIASNNFSPTCHLNDGDEVVCDWCAPGYSGAWCERCADGYYGNPT VPGESCVPCDCSGNVDPSEAGHCDSVTGECLKCLGNTDGAHCERCADGFYGDAVTAKNCR ACECHVKGSHSAVCHLETGLCDCKPNVTGQQCDQCLHGYYGLDSGHGCRPCNCSVAGSVS DGCTDEGQCHCVPGVAGKRCDRCAHGFYAYQDGSCTPCDCPHTQNTCDPETGECVCPPHT QGVKCEECEDGHWGYDAEVGCQACNCSLVGSTHHRCDVVTGHCQCKSKFGGRACDQCSLG YRDFPDCVPCDCDLRGTSGDACNLEQGLCGCVEETGACPCKENVFGPQCNECREGTFALR ADNPLGCSPCFCSGLSHLCSELEDYVRTPVTLGSDQPLLRVVSQSNLRGTTEGVYYQAPD FLLDAATVRQHIRAEPFYWRLPQQFQGDQLMAYGGKLKYSVAFYSLDGVGTSNFEPQVLI KGGRIRKQVIYMDAPAPENGVRQEQEVAMRENFWKYFNSVSEKPVTREDFMSVLSDIEYI LIKASYGQGLQQSRISDISMEVGRKAEKLHPEEEVASLLENCVCPPGTVGFSCQDCAPGY HRGKLPAGSDRGPRPLVAPCVPCSCNNHSDTCDPNTGKCLNCGDNTAGDHCDVCTSGYYG KVTGSASDCALCACPHSPPASFSPTCVLEGDHDFRCDACLLGYEGKHCERCSSSYYGNPQ TPGGSCQKCDCNPHGSVHGDCDRTSGQCVCRLGASGLRCDECEPRHILMETDCVSCDDEC VGVLLNDLDEIGDAVLSLNLTGIIPVPYGILSNLENTTKYLQESLLKENMQKDLGKIKLE GVAEETDNLQKKLTRMLASTQKVNRATERIFKESQDLAIAIERLQMSITEIMEKTTLNQT LDEDFLLPNSTLQNMQQNGTSLLEIMQIRDFTQLHQNATLELKAAEDLLSQIQENYQKPL EELEVLKEAASHVLSKHNNELKAAEALVREAEAKMQESNHLLLMVNANLREFSDKKLHVQ EEQNLTSELIVQGRGLIDAAAAQTDAVQDALEHLEDHQDKLLLWSAKIRHHIDDLVMHMS QRNAVDLVYRAEDHAAEFQRLADVLYSGLENIRNVSLNATSAAYVHYNIQSLIEESEELA RDAHRTVTETSLLSESLVSNGKAAVQRSSRFLKEGNNLSRKLPGIALELSELRNKTNRFQ ENAVEITRQTNESLLILRAIPKGIRDKGAKTKELATSASQSAVSTLRDVAGLSQELLNTS ASLSRVNTTLRETHQLLQDSTMATLLAGRKVKDVEIQANLLFDRLKPLKMLEENLSRNLS EIKLLISQARKQAASIKVAVSADRDCIRAYQPQISSTNYNTLTLNVKTQEPDNLLFYLGS STASDFLAVEMRRGRVAFLWDLGSGSTRLEFPDFPIDDNRWHSIHVARFGNIGSLSVKEM SSNQKSPTKTSKSPGTANVLDVNNSTLMFVGGLGGQIKKSPAVKVTHFKGCLGEAFLNGK SIGLWNYIEREGKCRGCFGSSQNEDPSFHFDGSGYSVVEKSLPATVTQIIMLFNTFSPNG LLLYLGSYGTKDFLSIELFRGRVKVMTDLGSGPITLLTDRRYNNGTWYKIAFQRNRKQGV LAVIDAYNTSNKETKQGETPGASSDLNRLDKDPIYVGGLPRSRVVRRGVTTKSFVGCIKN LEISRSTFDLLRNSYGVRKGCLLEPIRSVSFLKGGYIELPPKSLSPESEWLVTFATTNSS GIILAALGGDVEKRGDREEAHVPFFSVMLIGGNIEVHVNPGDGTGLRKALLHAPTGTCSD GQAHSISLVRNRRIITVQLDENNPVEMKLGTLVESRTINVSNLYVGGIPEGEGTSLLTMR RSFHGCIKNLIFNLELLDFNSAVGHEQVDLDTCWLSERPKLAPDAEDSKLLPEPRAFPEQ CVVDAALEYVPGAHQFGLTQNSHFILPFNQSAVRKKLSVELSIRTFASSGLIYYMAHQNQ ADYAVLQLHGGRLHFMFDLGKGRTKVSHPALLSDGKWHTVKTDYVKRKGFITVDGRESPM VTVVGDGTMLDVEGLFYLGGLPSQYQARKIGNITHSIPACIGDVTVNSKQLDKDSPVSAF TVNRCYAVAQEGTYFDGSGYAALVKEGYKVQSDVNITLEFRTSSQNGVLLGISTAKVDAI GLELVDGKVLFHVNNGAGRITAAYEPKTATVLCDGKWHTLQANKSKHRITLIVDGNAVGA ESPHTQSTSVDTNNPIYVGGYPAGVKQKCLRSQTSFRGCLRKLALIKSPQVQSFDFSRAF ELHGVFLHSCPGTES
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(32)-dbSNP:
complement(32)-g, adbSNP:334407
complement(125)-g, cdbSNP:149133081
complement(147)-t, cdbSNP:182087823
complement(214)-dbSNP:
complement(214)-g, adbSNP:188147882
complement(244)-g, adbSNP:184206783
complement(270)-t, cdbSNP:375547281
complement(275)-t, cdbSNP:147676957
complement(279)-t, cdbSNP:376345144
complement(306)-t, cdbSNP:201607431
complement(314)-t, cdbSNP:367866675
complement(329)-dbSNP:
complement(329)-g, adbSNP:373933623
complement(363)-t, cdbSNP:375957953
complement(366)-t, adbSNP:372942514
complement(424)-g, adbSNP:200230702
complement(465)-dbSNP:
complement(465)-g, adbSNP:200657079
complement(481)-g, adbSNP:146125430
complement(497)-g, adbSNP:201665173
complement(503)-t, adbSNP:78151989
complement(509)-g, adbSNP:199854892
complement(515)-g, adbSNP:142313158
complement(528)-g, adbSNP:77811721
complement(529)-t, cdbSNP:200618216
complement(556)-g, cdbSNP:149932824
complement(559)-g, adbSNP:192198427
complement(584)-t, gdbSNP:374638955
complement(593)-g, cdbSNP:139074285
complement(600)-t, cdbSNP:377017068
complement(604)-c, adbSNP:151175087
complement(606)-g, adbSNP:142127898
complement(625)-g, adbSNP:372452933
complement(648)-t, cdbSNP:139804199
complement(747)-dbSNP:
complement(747)-g, adbSNP:145953998
complement(759)-t, cdbSNP:112194576
complement(768)-t, cdbSNP:140718292
complement(782)-t, g, adbSNP:200844421
complement(793)-t, cdbSNP:146352388
complement(798)-t, cdbSNP:149410548
complement(824)-g, adbSNP:200626690
complement(825)-t, cdbSNP:138908205
complement(833)-t, cdbSNP:376469891
complement(847)-g, adbSNP:190504110
complement(860)-g, adbSNP:150637419
complement(875)-dbSNP:
complement(875)-t, cdbSNP:370249044
complement(927)-c, adbSNP:377346258
complement(978)-dbSNP:
complement(978)-t, cdbSNP:369274990
complement(994)-g, adbSNP:138289612
complement(1015)-g, adbSNP:373870531
complement(1038)-g, adbSNP:201386303
complement(1062)-t, g, adbSNP:147036555
complement(1107)-dbSNP:
complement(1107)-t, cdbSNP:376916699
complement(1140)-g, adbSNP:9950267
complement(1140)-g, adbSNP:111189027
complement(1147)-g, adbSNP:200366249
complement(1197)-g, adbSNP:374102814
complement(1237)-g, adbSNP:201646668
complement(1250)-dbSNP:
complement(1250)-t, cdbSNP:370681586
complement(1277)-g, adbSNP:148751644
complement(1278)-t, cdbSNP:143535609
complement(1307)-g, c, adbSNP:200500057
complement(1321)-g, adbSNP:201071404
complement(1327)-c, adbSNP:202160200
complement(1333)-t, gdbSNP:144278838
complement(1342)-g, adbSNP:201697440
complement(1368)-dbSNP:
complement(1368)-g, cdbSNP:368665310
complement(1394)-t, cdbSNP:62619829
complement(1441)-t, cdbSNP:183543858
complement(1474)-g, adbSNP:145761207
complement(1487)-t, cdbSNP:369134441
complement(1521)-dbSNP:
complement(1521)-t, cdbSNP:200035723
complement(1523)-t, cdbSNP:200193213
complement(1592)-g, adbSNP:376907008
complement(1625)-t, cdbSNP:149692121
complement(1668)-dbSNP:
complement(1668)-g, adbSNP:202033730
complement(1672)-g, adbSNP:368647137
complement(1682)-g, cdbSNP:375032577
complement(1705)-t, cdbSNP:370931259
complement(1713)-g, adbSNP:140908403
complement(1735)-g, adbSNP:146410687
complement(1736)-t, cdbSNP:377172724
complement(1747)-g, cdbSNP:374075138
complement(1765)-g, adbSNP:370351631
complement(1767)-g, adbSNP:143997842
complement(1769)-t, cdbSNP:16951079
complement(1796)-g, adbSNP:375730859
complement(1807)-g, adbSNP:142476912
complement(1810)-g, adbSNP:144105602
complement(1811)-t, cdbSNP:202157653
complement(1814)-t, cdbSNP:144361299
complement(1815)-g, cdbSNP:149575964
complement(1835)-dbSNP:
complement(1835)-t, gdbSNP:374647834
complement(1840)-t, cdbSNP:368609998
complement(1846)-g, adbSNP:138401018
complement(1848)-c, adbSNP:144395202
complement(1864)-t, cdbSNP:147447578
complement(1874)-t, cdbSNP:143022454
complement(1878)-g, adbSNP:374756793
complement(1879)-g, adbSNP:201400544
complement(1881)-g, adbSNP:139065838
complement(1882)-t, cdbSNP:150371854
complement(1883)-t, cdbSNP:140625362
complement(1886)-g, cdbSNP:116690149
complement(1890)-g, adbSNP:148234507
complement(1891)-t, cdbSNP:143137367
complement(1897)-g, adbSNP:111267165
complement(1911)-g, adbSNP:372377426
complement(1940)-dbSNP:
complement(1940)-t, cdbSNP:146460281
complement(1997)-g, cdbSNP:144060384
complement(2031)-t, cdbSNP:375469278
complement(2071)-t, cdbSNP:147417861
complement(2101)-c, adbSNP:142794671
2115+a, cdbSNP:566655
complement(2156)-dbSNP:
complement(2156)-t, cdbSNP:373498964
complement(2165)-t, cdbSNP:184077167
2203+c, tdbSNP:621993
complement(2230)-c, adbSNP:139988519
complement(2233)-t, cdbSNP:376668276
complement(2259)-dbSNP:
complement(2259)-g, adbSNP:369026696
complement(2260)-t, cdbSNP:376692947
complement(2280)-t, cdbSNP:144429570
complement(2281)-g, adbSNP:139947483
complement(2282)-t, cdbSNP:200570694
complement(2322)-t, cdbSNP:147477674
complement(2329)-g, adbSNP:143145158
complement(2330)-t, cdbSNP:372203316
complement(2337)-t, gdbSNP:199528568
complement(2339)-t, cdbSNP:368904555
complement(2356)-g, adbSNP:375427541
complement(2359)-g, adbSNP:148714534
complement(2371)-dbSNP:
complement(2371)-t, cdbSNP:377514465
complement(2377)-t, c, adbSNP:144236117
complement(2389)-g, adbSNP:149313689
complement(2393)-t, cdbSNP:149611371
complement(2417)-t, cdbSNP:28369373
complement(2425)-g, adbSNP:185274541
complement(2431)-t, cdbSNP:370879719
complement(2438)-g, adbSNP:374851540
complement(2443)-c, adbSNP:28687669
complement(2466)-t, cdbSNP:138065938
complement(2468)-t, cdbSNP:370543207
complement(2473)-g, adbSNP:145338419
complement(2481)-t, gdbSNP:368645823
complement(2517)-dbSNP:
complement(2517)-g, adbSNP:111634992
complement(2537)-t, cdbSNP:370325715
complement(2547)-g, cdbSNP:140314525
complement(2548)-g, cdbSNP:376146127
complement(2557)-t, cdbSNP:201917302
2582+a, cdbSNP:386352324
2587+dbSNP:
2587+c, tdbSNP:684634
complement(2609)-g, adbSNP:143031283
complement(2618)-g, adbSNP:149208354
complement(2624)-t, cdbSNP:369294134
complement(2654)-t, gdbSNP:145417931
complement(2656)-g, adbSNP:188317411
complement(2698)-t, cdbSNP:200170562
complement(2751)-g, adbSNP:144738522
complement(2769)-t, cdbSNP:374593442
complement(2770)-g, adbSNP:117614901
complement(2771)-t, cdbSNP:377014414
complement(2792)-g, adbSNP:201104095
complement(2794)-g, adbSNP:140067215
complement(2830)-dbSNP:
complement(2830)-g, adbSNP:147940620
complement(2847)-g, adbSNP:368652097
complement(2848)-g, adbSNP:200867771
complement(2849)-g, cdbSNP:201635937
complement(2857)-g, adbSNP:539713
complement(2858)-t, cdbSNP:371371596
complement(2865)-t, cdbSNP:374173894
complement(2872)-g, adbSNP:371323342
complement(2878)-g, adbSNP:199655492
complement(2890)-g, adbSNP:377341395
complement(2902)-g, cdbSNP:200562970
complement(2908)-dbSNP:
complement(2908)-g, adbSNP:77574121
complement(2930)-g, adbSNP:369361438
complement(2956)-g, adbSNP:371357986
complement(2957)-t, cdbSNP:150606453
complement(2968)-g, adbSNP:199612213
complement(2994)-t, cdbSNP:141851670
complement(3005)-g, adbSNP:374628932
complement(3015)-t, cdbSNP:371922576
complement(3020)-c, adbSNP:371127795
complement(3023)-t, cdbSNP:148515510
complement(3058)-g, adbSNP:200877901
complement(3059)-c, adbSNP:181556627
complement(3072)-g, cdbSNP:146026654
complement(3074)-t, cdbSNP:374316816
complement(3083)-g, adbSNP:148593258
complement(3115)-dbSNP:
complement(3115)-g, adbSNP:138024139
complement(3116)-t, cdbSNP:201891641
complement(3145)-g, adbSNP:377710246
complement(3156)-t, gdbSNP:371635074
complement(3200)-t, cdbSNP:145459658
complement(3204)-g, adbSNP:149260074
complement(3205)-t, cdbSNP:200710797
complement(3239)-dbSNP:
complement(3239)-t, cdbSNP:138476816
complement(3247)-t, cdbSNP:200733364
complement(3250)-g, adbSNP:115609096
complement(3257)-g, adbSNP:140681784
complement(3258)-t, cdbSNP:150940045
complement(3262)-g, adbSNP:147111783
complement(3263)-t, cdbSNP:141907708
complement(3265)-g, adbSNP:9953287
complement(3274)-g, adbSNP:34712919
complement(3283)-g, adbSNP:371303337
complement(3292)-t, cdbSNP:369017646
complement(3309)-c, adbSNP:118089415
complement(3349)-g, adbSNP:375804587
complement(3350)-t, cdbSNP:201831309
complement(3384)-g, adbSNP:377575918
complement(3385)-t, cdbSNP:187508906
complement(3388)-t, cdbSNP:149157836
complement(3409)-t, cdbSNP:112855474
complement(3440)-t, c, adbSNP:199554880
complement(3451)-c, adbSNP:372657948
complement(3457)-c, adbSNP:191922140
complement(3472)-dbSNP:
complement(3472)-g, adbSNP:9946794
complement(3484)-g, adbSNP:150019331
complement(3492)-t, cdbSNP:370246345
complement(3496)-c, adbSNP:113553100
complement(3506)-t, cdbSNP:146317153
complement(3508)-t, adbSNP:184460397
complement(3512)-g, adbSNP:149357158
complement(3513)-t, cdbSNP:201623766
complement(3514)-g, adbSNP:144126568
complement(3528)-g, adbSNP:371362853
complement(3589)-g, adbSNP:373605473
complement(3616)-dbSNP:
complement(3616)-g, adbSNP:139418084
complement(3617)-t, cdbSNP:146232089
complement(3638)-c, adbSNP:370865543
complement(3653)-g, adbSNP:141269552
complement(3664)-t, cdbSNP:148253534
complement(3667)-t, cdbSNP:386601899
3667+c, tdbSNP:619106
complement(3668)-t, cdbSNP:368852040
complement(3692)-t, cdbSNP:375915134
complement(3709)-g, adbSNP:79497917
complement(3710)-t, cdbSNP:202168119
complement(3711)-t, gdbSNP:372946104
complement(3716)-t, cdbSNP:369286165
complement(3720)-c, adbSNP:137905025
complement(3741)-g, adbSNP:146931651
complement(3742)-t, cdbSNP:12969598
complement(3753)-t, cdbSNP:367987988
complement(3778)-g, adbSNP:199997517
complement(3784)-dbSNP:
complement(3784)-g, adbSNP:139372717
complement(3792)-t, cdbSNP:146912301
complement(3794)-t, cdbSNP:141036112
complement(3818)-t, cdbSNP:115127419
complement(3819)-g, adbSNP:372314380
complement(3838)-g, adbSNP:141251142
complement(3839)-t, cdbSNP:148225763
complement(3841)-g, adbSNP:148956653
complement(3852)-t, cdbSNP:201808882
complement(3876)-t, cdbSNP:368362656
complement(3878)-c, adbSNP:377104998
complement(3885)-g, cdbSNP:371957816
complement(3911)-t, cdbSNP:367994203
complement(3912)-t, adbSNP:146775184
complement(3914)-t, cdbSNP:143604755
complement(4004)-dbSNP:
complement(4004)-g, cdbSNP:151275559
complement(4011)-g, adbSNP:374697577
complement(4034)-g, adbSNP:146952686
complement(4040)-t, cdbSNP:149753863
complement(4043)-t, cdbSNP:376148745
complement(4047)-t, gdbSNP:367972801
complement(4068)-g, adbSNP:375341685
complement(4069)-t, cdbSNP:187196123
complement(4076)-t, gdbSNP:370235290
4112+dbSNP:
4112+a, gdbSNP:662471
complement(4112)-g, adbSNP:386603967
complement(4120)-c, adbSNP:73938538
complement(4160)-t, cdbSNP:141657203
complement(4177)-g, adbSNP:377556261
complement(4201)-c, adbSNP:374423781
complement(4223)-dbSNP:
complement(4223)-t, cdbSNP:149298173
complement(4254)-g, adbSNP:138028986
complement(4274)-g, adbSNP:377516549
complement(4275)-t, cdbSNP:373119671
complement(4276)-g, adbSNP:200839776
complement(4298)-g, adbSNP:202133880
complement(4305)-c, adbSNP:147345095
complement(4342)-g, adbSNP:375908736
complement(4379)-dbSNP:
complement(4379)-t, g, cdbSNP:200862963
complement(4411)-g, adbSNP:142687012
complement(4438)-g, adbSNP:373094453
complement(4457)-g, adbSNP:201430047
complement(4462)-g, adbSNP:113218555
complement(4510)-dbSNP:
complement(4510)-g, adbSNP:12970643
complement(4518)-t, cdbSNP:199872720
complement(4525)-g, adbSNP:377102013
complement(4526)-t, cdbSNP:372497706
complement(4539)-t, cdbSNP:371972508
complement(4541)-c, adbSNP:368008526
complement(4555)-g, adbSNP:143389887
complement(4573)-dbSNP:
complement(4573)-t, cdbSNP:625106
complement(4585)-t, cdbSNP:138248122
complement(4588)-g, adbSNP:147381498
complement(4608)-t, cdbSNP:187937890
complement(4631)-g, adbSNP:201421953
complement(4632)-g, adbSNP:150459295
complement(4634)-g, adbSNP:140577242
complement(4644)-t, adbSNP:146822562
complement(4648)-g, adbSNP:145068849
complement(4661)-t, gdbSNP:141200670
complement(4662)-t, cdbSNP:202172989
complement(4668)-g, adbSNP:200483652
complement(4679)-t, cdbSNP:146559010
complement(4685)-t, g, adbSNP:142217818
complement(4687)-c, adbSNP:148691508
complement(4698)-g, adbSNP:144979101
complement(4699)-t, cdbSNP:375612209
complement(4706)-g, adbSNP:149937004
complement(4712)-t, cdbSNP:373453681
complement(4717)-c, adbSNP:201565963
complement(4732)-g, adbSNP:139693824
complement(4786)-dbSNP:
complement(4786)-t, cdbSNP:147374927
complement(4788)-g, adbSNP:142773789
complement(4805)-t, cdbSNP:267605256
complement(4806)-g, adbSNP:140296099
complement(4816)-g, adbSNP:370327276
complement(4817)-t, cdbSNP:150510890
complement(4823)-c, adbSNP:12961939
complement(4831)-g, adbSNP:201505782
complement(4835)-t, cdbSNP:148171853
complement(4846)-g, adbSNP:267605255
complement(4857)-t, adbSNP:369235031
complement(4865)-g, c, adbSNP:596315
complement(4890)-t, gdbSNP:184375207
complement(4943)-dbSNP:
complement(4943)-t, cdbSNP:142117946
complement(4971)-g, adbSNP:201454996
complement(4981)-t, cdbSNP:201365860
complement(4982..4983)-, tdbSNP:34806021
complement(4988)-t, cdbSNP:11872364
complement(4999)-dbSNP:
complement(4999)-t, cdbSNP:202123051
complement(5007)-g, adbSNP:145048578
complement(5017)-t, cdbSNP:141321442
complement(5053)-g, cdbSNP:145146950
complement(5069)-t, cdbSNP:62081533
complement(5086)-t, cdbSNP:199626631
complement(5112)-dbSNP:
complement(5112)-t, gdbSNP:140868195
complement(5139)-t, adbSNP:16950981
complement(5176)-g, adbSNP:142729521
complement(5177)-t, adbSNP:200511821
complement(5211)-c, adbSNP:78172771
complement(5244)-t, cdbSNP:369790608
complement(5311)-dbSNP:
complement(5311)-c, adbSNP:201901346
complement(5350)-g, adbSNP:62081531
complement(5365)-g, cdbSNP:201217414
complement(5369)-t, gdbSNP:369777673
complement(5374)-t, adbSNP:375219347
complement(5382)-g, adbSNP:12607841
complement(5389)-t, cdbSNP:371987322
complement(5392)-t, cdbSNP:200050759
complement(5396)-t, cdbSNP:73938527
complement(5398)-c, adbSNP:201040898
complement(5441)-g, adbSNP:369357307
complement(5485)-dbSNP:
complement(5485)-t, cdbSNP:617206
complement(5522)-t, adbSNP:185086681
complement(5555)-t, cdbSNP:368622181
complement(5575)-t, cdbSNP:138711280
complement(5606)-dbSNP:
complement(5606)-g, adbSNP:376548651
complement(5610)-t, adbSNP:199685044
complement(5649)-g, adbSNP:370467974
complement(5683)-t, gdbSNP:377710546
complement(5720)-t, cdbSNP:11664063
complement(5739)-g, cdbSNP:199940262
complement(5794)-dbSNP:
complement(5794)-t, gdbSNP:11661974
complement(5805)-t, cdbSNP:201437320
complement(5820)-g, adbSNP:199766289
complement(5841)-g, adbSNP:150900099
complement(5883)-g, adbSNP:142286229
complement(5884)-t, cdbSNP:138961424
complement(5888)-g, cdbSNP:115759032
complement(5896)-dbSNP:
complement(5896)-t, gdbSNP:368004074
complement(5907)-g, adbSNP:142825561
complement(5914)-g, adbSNP:368850544
complement(5922)-g, adbSNP:149983454
complement(5927)-t, cdbSNP:375358860
complement(5933)-g, adbSNP:370249336
complement(5960)-t, cdbSNP:367596930
complement(5961)-t, cdbSNP:117433399
complement(6054)-dbSNP:
complement(6054)-g, adbSNP:117303816
complement(6055)-t, gdbSNP:148925029
complement(6092)-t, cdbSNP:138747833
complement(6097)-g, adbSNP:147009546
complement(6098)-t, cdbSNP:607230
complement(6112)-dbSNP:
complement(6112)-g, cdbSNP:372377370
complement(6119)-t, cdbSNP:147813944
complement(6134)-g, adbSNP:9955616
complement(6158)-t, cdbSNP:140764072
complement(6160)-t, cdbSNP:150951157
complement(6168)-g, adbSNP:369357135
complement(6172)-t, cdbSNP:368365759
complement(6179)-t, cdbSNP:148215666
complement(6225)-g, adbSNP:142732096
complement(6246)-t, cdbSNP:145781920
complement(6283)-g, cdbSNP:144466305
complement(6294)-dbSNP:
complement(6294)-g, c, adbSNP:143853128
complement(6298)-t, cdbSNP:188817453
complement(6321)-g, adbSNP:671871
complement(6325)-t, adbSNP:371541660
complement(6332)-g, cdbSNP:199719835
complement(6344)-g, adbSNP:146111631
complement(6351)-t, gdbSNP:142934543
complement(6435)-g, cdbSNP:138291906
complement(6436)-g, adbSNP:376150556
complement(6448)-dbSNP:
complement(6448)-g, adbSNP:150849018
complement(6449)-t, cdbSNP:141494356
complement(6451)-g, adbSNP:148287322
complement(6471)-g, cdbSNP:369081096
complement(6489)-g, adbSNP:200348443
complement(6493)-g, cdbSNP:377477393
complement(6510)-t, cdbSNP:373330985
complement(6524)-g, cdbSNP:117225191
complement(6538)-t, adbSNP:370004150
complement(6568..6569)-, cdbSNP:35831966
complement(6568)-g, adbSNP:370095492
complement(6581)-t, cdbSNP:141405588
complement(6587)-dbSNP:
complement(6587)-c, adbSNP:370881774
complement(6618)-g, cdbSNP:138955237
complement(6629)-g, adbSNP:115169112
complement(6637)-g, adbSNP:375915290
complement(6646)-g, adbSNP:149288175
complement(6656)-g, adbSNP:202184749
complement(6671)-c, adbSNP:149080936
complement(6708)-t, cdbSNP:113762855
complement(6738)-dbSNP:
complement(6738)-g, adbSNP:145026691
complement(6742)-g, adbSNP:377764172
complement(6777)-g, cdbSNP:374082294
complement(6802)-t, cdbSNP:149903566
complement(6806)-t, cdbSNP:188619033
complement(6819)-g, adbSNP:200127612
complement(6823)-g, adbSNP:369697673
complement(6854)-t, cdbSNP:140199044
complement(6864)-c, adbSNP:184034913
complement(6873)-dbSNP:
complement(6873)-t, gdbSNP:146652610
complement(6895)-g, adbSNP:200986684
complement(6913)-t, cdbSNP:615809
complement(6934)-t, cdbSNP:113914459
complement(6938)-t, cdbSNP:201633658
complement(6939)-g, adbSNP:146148365
complement(6941)-t, cdbSNP:142996896
complement(6944)-g, adbSNP:77810945
complement(6951)-t, cdbSNP:140461312
complement(6954)-t, cdbSNP:375511472
complement(6976)-g, adbSNP:199998473
complement(6977)-g, adbSNP:76842111
complement(6978)-t, cdbSNP:369777404
complement(6982)-t, cdbSNP:200503156
complement(6994)-dbSNP:
complement(6994)-g, adbSNP:73390557
complement(7004)-t, cdbSNP:144788432
complement(7027)-g, adbSNP:149366807
complement(7028)-t, cdbSNP:138821699
complement(7057)-t, cdbSNP:147238612
complement(7062)-g, adbSNP:375262660
complement(7063)-t, cdbSNP:368041323
complement(7085)-t, cdbSNP:143815838
complement(7098)-t, gdbSNP:373670761
complement(7137)-t, adbSNP:56269539
complement(7159)-dbSNP:
complement(7159)-g, adbSNP:138326363
complement(7162)-g, adbSNP:146125302
complement(7168)-g, cdbSNP:376634498
complement(7173)-t, cdbSNP:141811330
complement(7184)-t, cdbSNP:199509318
complement(7204)-g, adbSNP:374778673
complement(7212)-t, gdbSNP:148021285
complement(7230)-t, adbSNP:372144286
complement(7235)-g, adbSNP:142063208
complement(7236)-t, cdbSNP:113764106
complement(7237)-g, adbSNP:16950892
complement(7254)-g, cdbSNP:146701430
complement(7257)-t, cdbSNP:144702457
complement(7258)-g, adbSNP:184563378
complement(7265)-c, adbSNP:192340222
complement(7275)-t, cdbSNP:140792199
complement(7281)-t, cdbSNP:200776408
complement(7306)-dbSNP:
complement(7306)-g, adbSNP:146438640
complement(7307)-t, cdbSNP:371549771
complement(7314)-t, cdbSNP:199811630
complement(7339)-t, cdbSNP:150049939
complement(7370)-g, adbSNP:139416724
complement(7393)-t, cdbSNP:369306891
complement(7398)-t, cdbSNP:187493441
complement(7405)-g, adbSNP:151291963
complement(7484)-dbSNP:
complement(7484)-g, adbSNP:371859724
complement(7533)-c, adbSNP:368012390
complement(7540)-t, cdbSNP:145257845
complement(7553)-dbSNP:
complement(7553)-g, adbSNP:372517307
complement(7554)-t, cdbSNP:180910009
complement(7568)-g, adbSNP:73390547
complement(7576)-g, adbSNP:369257165
complement(7612)-t, cdbSNP:375050871
complement(7625)-t, gdbSNP:60009920
complement(7644)-g, adbSNP:376219041
complement(7679)-t, cdbSNP:373829095
complement(7694)-g, adbSNP:376978539
complement(7695)-t, cdbSNP:200639472
complement(7704)-t, cdbSNP:372523357
complement(7717)-g, adbSNP:199744967
complement(7733)-dbSNP:
complement(7733)-t, cdbSNP:367598361
complement(7753)-g, cdbSNP:143933905
complement(7768)-g, cdbSNP:73390534
complement(7810)-g, adbSNP:73390532
complement(7814)-t, gdbSNP:200193936
complement(7818)-g, adbSNP:76482057
complement(7819)-t, cdbSNP:138095695
complement(7830)-t, cdbSNP:73390531
complement(7842)-g, adbSNP:141247075
complement(7857)-g, adbSNP:182068076
complement(7868)-g, adbSNP:373755843
complement(7886)-dbSNP:
complement(7886)-t, gdbSNP:375910365
complement(7924)-t, gdbSNP:374593621
complement(7925)-t, g, cdbSNP:543355
complement(7941)-t, cdbSNP:144672024
complement(7962)-g, adbSNP:140908333
complement(7966)-g, adbSNP:370566659
complement(7967)-t, cdbSNP:370352054
complement(7969)-g, adbSNP:114578861
complement(8025)-t, adbSNP:146411016
complement(8036)-t, gdbSNP:200204767
complement(8057)-g, cdbSNP:73390524
complement(8073)-dbSNP:
complement(8073)-t, cdbSNP:149000406
8085+a, cdbSNP:683733
complement(8109)-g, adbSNP:377109532
complement(8143)-g, adbSNP:145856205
complement(8187)-g, adbSNP:369310468
complement(8215)-dbSNP:
complement(8215)-t, cdbSNP:143844687
complement(8228)-t, cdbSNP:149861792
complement(8231)-t, cdbSNP:372270046
complement(8275)-g, adbSNP:199656824
complement(8282)-g, adbSNP:368263726
complement(8287)-t, cdbSNP:140909370
complement(8288)-t, cdbSNP:147730906
complement(8296)-t, gdbSNP:200864652
complement(8308)-dbSNP:
complement(8308)-c, adbSNP:199886038
complement(8317)-t, gdbSNP:145398064
complement(8324)-g, adbSNP:185076723
complement(8325)-t, cdbSNP:369422681
complement(8329)-t, cdbSNP:139987349
complement(8332)-g, adbSNP:150815120
complement(8345)-t, gdbSNP:55731565
complement(8347)-t, cdbSNP:139713073
complement(8356)-g, adbSNP:375402764
complement(8357)-t, cdbSNP:373014487
8391+a, gdbSNP:77885852
complement(8400)-t, cdbSNP:369047480
complement(8401)-g, adbSNP:148724560
complement(8402)-g, cdbSNP:368663897
complement(8411)-g, adbSNP:144592838
complement(8429)-g, adbSNP:181694782
complement(8468)-g, adbSNP:201898471
complement(8497)-dbSNP:
complement(8497)-t, cdbSNP:147737122
complement(8526)-g, adbSNP:188144413
complement(8534)-t, cdbSNP:367927216
complement(8536)-g, adbSNP:138633363
complement(8541)-t, cdbSNP:200996196
complement(8547)-g, cdbSNP:146003003
complement(8548)-g, adbSNP:145580032
complement(8592..8593)-, cdbSNP:35759306
complement(8593)-t, cdbSNP:199939399
complement(8642)-t, adbSNP:370696638
complement(8649)-t, gdbSNP:374227019
complement(8681)-dbSNP:
complement(8681)-t, cdbSNP:137948858
complement(8699)-t, cdbSNP:370891110
complement(8708)-t, cdbSNP:377153273
complement(8717)-t, gdbSNP:148737122
complement(8725)-t, cdbSNP:372751048
complement(8788)-g, adbSNP:199804823
complement(8789)-t, cdbSNP:369240094
complement(8820)-dbSNP:
complement(8820)-t, cdbSNP:181754075
complement(8830)-t, cdbSNP:78279255
complement(8844)-g, adbSNP:376554656
complement(8856)-t, cdbSNP:371871409
complement(8866)-t, cdbSNP:200288446
complement(8870)-t, adbSNP:201060955
complement(8933)-t, g, cdbSNP:140080119
complement(8987)-dbSNP:
complement(8987)-t, cdbSNP:375095121
8996+g, tdbSNP:77084609
complement(8997)-g, adbSNP:202107482
complement(8998..8999)-, ggdbSNP:138279997
complement(8998)-t, g, adbSNP:199752725
complement(9030)-g, adbSNP:376100751
complement(9043)-g, adbSNP:189191079
complement(9056)-g, adbSNP:138692442
9076+c, tdbSNP:2016639
complement(9077)-g, cdbSNP:199862694
complement(9091)-g, adbSNP:372452225
complement(9092)-t, cdbSNP:369082897
complement(9111)-t, cdbSNP:377015360
complement(9146)-t, cdbSNP:142640518
complement(9198)-dbSNP:
complement(9198)-g, adbSNP:147708500
complement(9204)-t, cdbSNP:201185017
complement(9205)-g, adbSNP:145569942
complement(9206)-t, cdbSNP:371758670
complement(9217)-t, cdbSNP:141619176
complement(9240)-g, adbSNP:201639941
complement(9241)-t, cdbSNP:145749697
complement(9266)-t, cdbSNP:111736762
complement(9271)-t, cdbSNP:149807552
complement(9283)-g, adbSNP:367601248
complement(9307)-c, adbSNP:139690829
complement(9333)-t, cdbSNP:374347282
complement(9373)-t, cdbSNP:372168857
complement(9437)-t, adbSNP:145252830
complement(9438)-t, cdbSNP:145733881
complement(9449)-g, adbSNP:374277637
complement(9564)-g, adbSNP:185502679
Gene SymbolLAMA1
Gene SynonymLAMA; S-LAM-alpha
Chromosome18
Locus Map18p11.3
Title The extracellular matrix is a novel attribute of endothelial progenitors and of hypoxic mature endothelial cells .
Author Kusuma S, Zhao S and Gerecht S.
Journal FASEB J. 26 (12), 4925-4936 (2012)
Title Unique preservation of neural cells in Hutchinson- Gilford progeria syndrome is due to the expression of the neural-specific miR-9 microRNA .
Author Nissan X, Blondel S, Navarro C, Maury Y, Denis C, Girard M, Martinat C, De Sandre-Giovannoli A, Levy N and Peschanski M.
Journal Cell Rep 2 (1), 1-9 (2012)
Title Stratifying type 2 diabetes cases by BMI identifies genetic risk variants in LAMA1 and enrichment for risk variants in lean compared to obese cases .
Author Perry JR, Voight BF, Yengo L, Amin N, Dupuis J, Ganser M, Grallert H, Navarro P, Li M, Qi L, Steinthorsdottir V, Scott RA, Almgren P, Arking DE, Aulchenko Y, Balkau B, Benediktsson R, Bergman RN, Boerwinkle E, Bonnycastle L, Burtt NP, Campbell H, Charpentier G, Collins FS, Gieger C, Green T, Hadjadj S, Hattersley AT, Herder C, Hofman A, Johnson AD, Kottgen A, Kraft P, Labrune Y, Langenberg C, Manning AK, Mohlke KL, Morris AP, Oostra B, Pankow J, Petersen AK, Pramstaller PP, Prokopenko I, Rathmann W, Rayner W, Roden M, Rudan I, Rybin D, Scott LJ, Sigurdsson G, Sladek R, Thorleifsson G, Thorsteinsdottir U, Tuomilehto J, Uitterlinden AG, Vivequin S, Weedon MN, Wright AF, Hu FB, Illig T, Kao L, Meigs JB, Wilson JF, Stefansson K, van Duijn C, Altschuler D, Morris AD, Boehnke M, McCarthy MI, Froguel P, Palmer CN, Wareham NJ, Groop L, Frayling TM and Cauchi S.
Journal PLoS Genet. 8 (5), E1002741 (2012)
Title Laminin-alpha1 LG4-5 domain binding to dystroglycan mediates muscle cell survival, growth, and the AP-1 and NF-kappaB transcription factors but also has adverse effects .
Author Zhou YW, Munoz J, Jiang D and Jarrett HW.
Journal Am. J. Physiol., Cell Physiol. 302 (6), C902-C914 (2012)
Title Genome-wide pharmacogenomic study of citalopram-induced side effects in STAR*D .
Author Adkins DE, Clark SL, Aberg K, Hettema JM, Bukszar J, McClay JL, Souza RP and van den Oord EJ.
Journal Transl Psychiatry 2, E129 (2012)
Title Primary structure of the human laminin A chain. Limited expression in human tissues .
Author Nissinen M, Vuolteenaho R, Boot-Handford R, Kallunki P and Tryggvason K.
Journal Biochem. J. 276 (PT 2), 369-379 (1991)
Title Molecular cloning of the cDNA encoding human laminin A chain .
Author Haaparanta T, Uitto J, Ruoslahti E and Engvall E.
Journal Matrix 11 (3), 151-160 (1991)
Title Distribution and isolation of four laminin variants; tissue restricted distribution of heterotrimers assembled from five different subunits .
Author Engvall E, Earwicker D, Haaparanta T, Ruoslahti E and Sanes JR.
Journal Cell Regul. 1 (10), 731-740 (1990)
Title Sulfatide-binding domain of the laminin A chain .
Author Taraboletti G, Rao CN, Krutzsch HC, Liotta LA and Roberts DD.
Journal J. Biol. Chem. 265 (21), 12253-12258 (1990)
Title Human laminin A chain (LAMA) gene: chromosomal mapping to locus 18p11.3 .
Author Nagayoshi T, Mattei MG, Passage E, Knowlton R, Chu ML and Uitto J.
Journal Genomics 5 (4), 932-935 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.