• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens lysosomal-associated membrane protein 1 (LAMP1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005561 Homo sapiens lysosomal-associated membrane protein 1 (LAMP1), mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_005561.3, 112380627
Length 2560 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens lysosomal-associated membrane protein 1 (LAMP1), mRNA.
Product lysosome-associated membrane glycoprotein 1 precursor
Comment

Summary: The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis. [provided by RefSeq, Jul 2008].

RefSeq NP_005552.3
CDS 282..1535
Misc Feature(1)366..863
Misc Feature(2)390..392
Misc Feature(3)order(402..404,519..521)
Misc Feature(4)414..416
Misc Feature(5)465..467
Misc Feature(6)507..509
Misc Feature(7)531..533
Misc Feature(8)588..590
Misc Feature(9)600..602
Misc Feature(10)612..1532
Misc Feature(11)642..644
Misc Feature(12)669..671
Misc Feature(13)order(744..746,852..854)
Misc Feature(14)774..776
Misc Feature(15)822..824
Misc Feature(16)864..962
Misc Feature(17)870..872
Misc Feature(18)876..878
Misc Feature(19)879..881
Misc Feature(20)900..902
Misc Feature(21)906..908
Misc Feature(22)912..914
Misc Feature(23)948..950
Misc Feature(24)963..1427
Misc Feature(25)963..965
Misc Feature(26)order(972..974,1086..1088)
Misc Feature(27)1002..1004
Misc Feature(28)1026..1028
Misc Feature(29)1062..1064
Misc Feature(30)1158..1160
Misc Feature(31)1245..1247
Misc Feature(32)order(1293..1295,1404..1406)
Misc Feature(33)1428..1496
Exon (1)1..342
Gene:LAMP1
Gene Synonym:CD107a; LAMPA; LGP120
Exon (2)343..464
Gene:LAMP1
Gene Synonym:CD107a; LAMPA; LGP120
Exon (3)465..684
Gene:LAMP1
Gene Synonym:CD107a; LAMPA; LGP120
Exon (4)685..843
Gene:LAMP1
Gene Synonym:CD107a; LAMPA; LGP120
Exon (5)844..1031
Gene:LAMP1
Gene Synonym:CD107a; LAMPA; LGP120
Exon (6)1032..1157
Gene:LAMP1
Gene Synonym:CD107a; LAMPA; LGP120
Exon (7)1158..1224
Gene:LAMP1
Gene Synonym:CD107a; LAMPA; LGP120
Exon (8)1225..1395
Gene:LAMP1
Gene Synonym:CD107a; LAMPA; LGP120
Exon (9)1396..2540
Gene:LAMP1
Gene Synonym:CD107a; LAMPA; LGP120
Translation MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGP KNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVY NLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLS NSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQL NLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFF LQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAFSVNIFKVWVQ AFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
30+dbSNP:
30+c, gdbSNP:113228666
140+c, tdbSNP:186336451
230+a, cdbSNP:188339460
254+c, tdbSNP:7983578
261+c, tdbSNP:144852732
349+dbSNP:
349+c, tdbSNP:180717643
355+a, gdbSNP:200783496
358+c, tdbSNP:199700645
388+a, gdbSNP:74628343
392+c, tdbSNP:184787579
444+a, gdbSNP:201650159
488+dbSNP:
488+a, tdbSNP:77735431
490+a, gdbSNP:200032545
510+c, tdbSNP:61750829
511+a, gdbSNP:61750830
610+a, gdbSNP:142333942
655+a, cdbSNP:113219412
660+c, gdbSNP:111455645
761+dbSNP:
761+a, gdbSNP:55898120
783+a, gdbSNP:191812061
835..837+, gccdbSNP:199777509
837+a, cdbSNP:9577503
846+dbSNP:
846+a, tdbSNP:112228471
892+c, tdbSNP:9577229
907+c, tdbSNP:200052831
926+a, gdbSNP:56313942
1133+dbSNP:
1133+c, tdbSNP:139701558
1174+dbSNP:
1174+a, gdbSNP:201021547
1193+c, tdbSNP:41286618
1207+c, tdbSNP:9577230
1217+c, tdbSNP:184805902
1226+dbSNP:
1226+c, tdbSNP:200239310
1240+c, gdbSNP:41286620
1247+c, tdbSNP:2270393
1262+a, gdbSNP:200140748
1268+a, gdbSNP:151133886
1298+c, tdbSNP:201877351
1316+c, tdbSNP:116326724
1597+dbSNP:
1597+a, cdbSNP:138594896
1638+a, gdbSNP:184906622
1671+c, gdbSNP:189770497
1849+c, gdbSNP:9577506
1850+c, tdbSNP:185994999
1864+g, tdbSNP:112130650
1900+c, tdbSNP:9577507
1901+c, tdbSNP:9577508
1997+c, tdbSNP:1803895
2110+a, gdbSNP:186117631
2177+a, cdbSNP:8001808
2269+a, gdbSNP:11541825
2270+a, gdbSNP:202113105
2289+c, tdbSNP:111453566
2359..2360+, t, ttdbSNP:141255835
2359+a, tdbSNP:9603825
2364..2365+, tdbSNP:200600258
2365+, adbSNP:67917604
2365+a, tdbSNP:3945894
2366..2367+, tdbSNP:3833987
2415+c, tdbSNP:1057122
2419+a, gdbSNP:191066173
2427+c, tdbSNP:15203
2441+g, tdbSNP:3197762
2443+c, tdbSNP:148293839
2450+a, cdbSNP:1803896
2474+a, gdbSNP:182357515
Gene SymbolLAMP1
Gene SynonymCD107a; LAMPA; LGP120
Chromosome13
Locus Map13q34
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005561 Homo sapiens lysosomal-associated membrane protein 1 (LAMP1), mRNA. On-demand $699.00 18
Title Generation and characterization of a lysosomally targeted, genetically encoded Ca(2+)-sensor .
Author McCue,H.V., Wardyn,J.D., Burgoyne,R.D. and Haynes,L.P.
Journal Biochem. J. 449 (2), 449-457 (2013)
Title The lysosomal polypeptide transporter TAPL is stabilized by interaction with LAMP-1 and LAMP-2 .
Author Demirel,O., Jan,I., Wolters,D., Blanz,J., Saftig,P., Tampe,R. and Abele,R.
Journal J. Cell. Sci. 125 (PT 18), 4230-4240 (2012)
Title Expression of NKG2D and CD107 in CD8(+) effector memory lymphocytes in Churg-Strauss syndrome .
Author Boita,M., Rolla,G., Mallone,R., Martinuzzi,E., Heffler,E., Circosta,P., Elia,A.R., Cignetti,A., Caillat-Zucman,S., de Menthon,M. and Guida,G.
Journal Clin. Exp. Rheumatol. 30 (1 SUPPL 70), S57-S61 (2012)
Title Effects of human full-length amelogenin on the proliferation of human mesenchymal stem cells derived from bone marrow .
Author Huang,Y.C., Tanimoto,K., Tanne,Y., Kamiya,T., Kunimatsu,R., Michida,M., Yoshioka,M., Yoshimi,Y., Kato,Y. and Tanne,K.
Journal Cell Tissue Res. 342 (2), 205-212 (2010)
Title Nucleolin, a shuttle protein promoting infection of human monocytes by Francisella tularensis .
Author Barel,M., Meibom,K. and Charbit,A.
Journal PLoS ONE 5 (12), E14193 (2010)
Title Confirmation of the chromosomal localization of human lamp genes and their exclusion as candidate genes for Salla disease .
Author Schleutker,J., Haataja,L., Renlund,M., Puhakka,L., Viitala,J., Peltonen,L. and Aula,P.
Journal Hum. Genet. 88 (1), 95-97 (1991)
Title The polylactosaminoglycans of human lysosomal membrane glycoproteins lamp-1 and lamp-2. Localization on the peptide backbones .
Author Carlsson,S.R. and Fukuda,M.
Journal J. Biol. Chem. 265 (33), 20488-20495 (1990)
Title Two human lysosomal membrane glycoproteins, h-lamp-1 and h-lamp-2, are encoded by genes localized to chromosome 13q34 and chromosome Xq24-25, respectively .
Author Mattei,M.G., Matterson,J., Chen,J.W., Williams,M.A. and Fukuda,M.
Journal J. Biol. Chem. 265 (13), 7548-7551 (1990)
Title Structure of human lysosomal membrane glycoprotein 1. Assignment of disulfide bonds and visualization of its domain arrangement .
Author Carlsson,S.R. and Fukuda,M.
Journal J. Biol. Chem. 264 (34), 20526-20531 (1989)
Title Purification and characterization of human lysosomal membrane glycoproteins .
Author Mane,S.M., Marzella,L., Bainton,D.F., Holt,V.K., Cha,Y., Hildreth,J.E. and August,J.T.
Journal Arch. Biochem. Biophys. 268 (1), 360-378 (1989)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.