• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens lysosomal-associated membrane protein 1 (LAMP1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu09610 Homo sapiens lysosomal-associated membrane protein 1 (LAMP1), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu09610C Homo sapiens lysosomal-associated membrane protein 1 (LAMP1), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_005561.3, 112380627
Length 1254 bp
Structure linear
Update Date 12-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens lysosomal-associated membrane protein 1 (LAMP1), mRNA.
Product lysosome-associated membrane glycoprotein 1 precursor
Comment

Summary: The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis. [provided by RefSeq, Jul 2008].

RefSeq NP_005552.3
CDS 282..1535
Misc Feature(1)366..863
Misc Feature(2)390..392
Misc Feature(3)order(402..404,519..521)
Misc Feature(4)414..416
Misc Feature(5)465..467
Misc Feature(6)507..509
Misc Feature(7)531..533
Misc Feature(8)588..590
Misc Feature(9)600..602
Misc Feature(10)612..1532
Misc Feature(11)642..644
Misc Feature(12)669..671
Misc Feature(13)order(744..746,852..854)
Misc Feature(14)774..776
Misc Feature(15)822..824
Misc Feature(16)864..962
Misc Feature(17)870..872
Misc Feature(18)876..878
Misc Feature(19)879..881
Misc Feature(20)900..902
Misc Feature(21)906..908
Misc Feature(22)912..914
Misc Feature(23)948..950
Misc Feature(24)963..1427
Misc Feature(25)963..965
Misc Feature(26)order(972..974,1086..1088)
Misc Feature(27)1002..1004
Misc Feature(28)1026..1028
Misc Feature(29)1062..1064
Misc Feature(30)1158..1160
Misc Feature(31)1245..1247
Misc Feature(32)order(1293..1295,1404..1406)
Misc Feature(33)1422..1514
Misc Feature(34)order(1425..1430,1437..1442,1446..1454,1458..1463,
Misc Feature(35)1428..1496
Exon (1)1..342
Gene:LAMP1
Gene Synonym:CD107a; LAMPA; LGP120
Exon (2)343..464
Gene:LAMP1
Gene Synonym:CD107a; LAMPA; LGP120
Exon (3)465..684
Gene:LAMP1
Gene Synonym:CD107a; LAMPA; LGP120
Exon (4)685..843
Gene:LAMP1
Gene Synonym:CD107a; LAMPA; LGP120
Exon (5)844..1031
Gene:LAMP1
Gene Synonym:CD107a; LAMPA; LGP120
Exon (6)1032..1157
Gene:LAMP1
Gene Synonym:CD107a; LAMPA; LGP120
Exon (7)1158..1224
Gene:LAMP1
Gene Synonym:CD107a; LAMPA; LGP120
Exon (8)1225..1395
Gene:LAMP1
Gene Synonym:CD107a; LAMPA; LGP120
Exon (9)1396..2540
Gene:LAMP1
Gene Synonym:CD107a; LAMPA; LGP120
Translation MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGP KNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVY NLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLS NSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQL NLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFF LQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAFSVNIFKVWVQ AFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
30+dbSNP:
30+c, gdbSNP:113228666
140+c, tdbSNP:186336451
230+a, cdbSNP:188339460
254+c, tdbSNP:7983578
261+c, tdbSNP:144852732
347+dbSNP:
347+c, gdbSNP:375926415
349+c, tdbSNP:180717643
355+a, gdbSNP:200783496
356+g, tdbSNP:370111946
358+c, tdbSNP:199700645
388+a, gdbSNP:74628343
392+c, tdbSNP:184787579
398+c, tdbSNP:372572919
401+g, tdbSNP:375160189
444+a, gdbSNP:201650159
472+dbSNP:
472+c, tdbSNP:369224631
488+a, tdbSNP:77735431
490+a, gdbSNP:200032545
506+c, gdbSNP:369272384
510+c, tdbSNP:61750829
511+a, gdbSNP:61750830
595+c, tdbSNP:377651869
609+c, tdbSNP:370862051
610+a, gdbSNP:142333942
618+a, gdbSNP:374537669
639+g, tdbSNP:376324908
655+a, cdbSNP:113219412
660+c, gdbSNP:111455645
692+dbSNP:
692+c, gdbSNP:368162623
761+a, gdbSNP:55898120
768+a, gdbSNP:373899040
772+a, gdbSNP:375227374
782+c, tdbSNP:371847599
783+a, gdbSNP:191812061
788+a, gdbSNP:369180138
808+a, cdbSNP:372906564
835..837+, gccdbSNP:199777509
837+a, cdbSNP:9577503
846+dbSNP:
846+a, tdbSNP:112228471
849+c, tdbSNP:371918328
884+a, gdbSNP:374933256
892+c, tdbSNP:9577229
907+c, tdbSNP:200052831
917+c, tdbSNP:376761620
926+a, gdbSNP:56313942
1009+c, tdbSNP:369669372
1033+dbSNP:
1033+c, tdbSNP:370286796
1091+c, tdbSNP:373542595
1133+c, tdbSNP:139701558
1159+dbSNP:
1159+a, gdbSNP:375412629
1174+a, gdbSNP:201021547
1186+a, gdbSNP:371542422
1193+c, tdbSNP:41286618
1195+a, gdbSNP:369159731
1207+c, tdbSNP:9577230
1217+c, tdbSNP:184805902
1226+dbSNP:
1226+c, tdbSNP:200239310
1240+c, gdbSNP:41286620
1247+c, tdbSNP:2270393
1248+a, gdbSNP:371034089
1261+c, tdbSNP:374678550
1262+a, gdbSNP:200140748
1268+a, gdbSNP:151133886
1277+c, tdbSNP:374840461
1298+c, tdbSNP:201877351
1301+a, gdbSNP:372087869
1316+c, tdbSNP:116326724
1322+a, gdbSNP:376013627
1328+a, gdbSNP:368427348
1346+c, tdbSNP:372370740
1415+dbSNP:
1415+c, tdbSNP:372917889
1416+a, gdbSNP:377137046
1473+a, gdbSNP:370899258
1475+c, tdbSNP:374673267
1484+c, tdbSNP:377066074
1502+c, gdbSNP:371265207
1508+c, gdbSNP:375930278
1514+c, tdbSNP:367740277
1517+a, tdbSNP:370190466
1546+a, gdbSNP:374070870
1548+a, gdbSNP:367958563
1597+a, cdbSNP:138594896
1638+a, gdbSNP:184906622
1671+c, gdbSNP:189770497
1849+c, gdbSNP:9577506
1850+c, tdbSNP:185994999
1864+g, tdbSNP:112130650
1900+c, tdbSNP:9577507
1901+c, tdbSNP:9577508
1949+c, tdbSNP:370192792
1997+c, tdbSNP:1803895
2110+a, gdbSNP:186117631
2177+a, cdbSNP:8001808
complement(2269)-g, adbSNP:11541825
2270+a, gdbSNP:202113105
2289+c, tdbSNP:111453566
2295+c, tdbSNP:372926640
2359..2360+, t, ttdbSNP:141255835
2359+a, tdbSNP:9603825
2365+a, tdbSNP:3945894
2368..2369+, tdbSNP:3833987
2415+c, tdbSNP:1057122
2419+a, gdbSNP:191066173
2427+c, tdbSNP:15203
2441+g, tdbSNP:3197762
2443+c, tdbSNP:148293839
2450+a, cdbSNP:1803896
2474+a, gdbSNP:182357515
Gene SymbolLAMP1
Gene SynonymCD107a; LAMPA; LGP120
Chromosome13
Locus Map13q34
Title Lysosome-associated protein 1 (LAMP-1) and lysosome-associated protein 2 (LAMP-2) in a larger family carrier of Fabry disease .
Author Pereira EM, do Monte SJ, do Nascimento FF, de Castro JA, Sousa JL, Filho HC, da Silva RN, Labilloy A, Monte Neto JT and da Silva AS.
Journal Gene 536 (1), 118-122 (2014)
Title Surface CD107a/LAMP-1 protects natural killer cells from degranulation-associated damage .
Author Cohnen A, Chiang SC, Stojanovic A, Schmidt H, Claus M, Saftig P, Janssen O, Cerwenka A, Bryceson YT and Watzl C.
Journal Blood 122 (8), 1411-1418 (2013)
Title Expression of the lysosomal-associated membrane protein-1 (LAMP-1) in astrocytomas .
Author Jensen SS, Aaberg-Jessen C, Christensen KG and Kristensen B.
Journal Int J Clin Exp Pathol 6 (7), 1294-1305 (2013)
Title LAMP1/CD107a is required for efficient perforin delivery to lytic granules and NK-cell cytotoxicity .
Author Krzewski K, Gil-Krzewska A, Nguyen V, Peruzzi G and Coligan JE.
Journal Blood 121 (23), 4672-4683 (2013)
Title Stimulation of CD107 affects LPS-induced cytokine secretion and cellular adhesion through the ERK signaling pathway in the human macrophage-like cell line, THP-1 .
Author Min BK, Suk K and Lee WH.
Journal Cell. Immunol. 281 (2), 122-128 (2013)
Title Confirmation of the chromosomal localization of human lamp genes and their exclusion as candidate genes for Salla disease .
Author Schleutker J, Haataja L, Renlund M, Puhakka L, Viitala J, Peltonen
Journal Hum. Genet. 88 (1), 95-97 (1991)
Title The polylactosaminoglycans of human lysosomal membrane glycoproteins lamp-1 and lamp-2. Localization on the peptide backbones .
Author Carlsson SR and Fukuda M.
Journal J. Biol. Chem. 265 (33), 20488-20495 (1990)
Title Two human lysosomal membrane glycoproteins, h-lamp-1 and h-lamp-2, are encoded by genes localized to chromosome 13q34 and chromosome Xq24-25, respectively .
Author Mattei MG, Matterson J, Chen JW, Williams MA and Fukuda M.
Journal J. Biol. Chem. 265 (13), 7548-7551 (1990)
Title Structure of human lysosomal membrane glycoprotein 1. Assignment of disulfide bonds and visualization of its domain arrangement .
Author Carlsson SR and Fukuda M.
Journal J. Biol. Chem. 264 (34), 20526-20531 (1989)
Title Purification and characterization of human lysosomal membrane glycoproteins .
Author Mane SM, Marzella L, Bainton DF, Holt VK, Cha Y, Hildreth JE and August JT.
Journal Arch. Biochem. Biophys. 268 (1), 360-378 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.