Homo sapiens POU class 3 homeobox 2 (POU3F2), mRNA.
| RefSeq Version | NM_005604.2, 51702520 |
| Length | 4172 bp |
| Structure | linear |
| Update Date | 13-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens POU class 3 homeobox 2 (POU3F2), mRNA. |
| Product | POU domain, class 3, transcription factor 2 |
| Comment | Summary: POU3F2 belongs to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, that occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1; MIM 164175) and Oct2 (POU2F2; MIM 164176) and the pituitary protein Pit1 (PIT1; MIM 173110). Class III POU genes are expressed predominantly in the central nervous system (CNS). It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression (Schreiber et al., 1993 [PubMed 8441633]; Atanasoski et al., 1995 [PubMed 7601453]).[supplied by OMIM]. |
| RefSeq | NP_005595.2 |
| CDS | 171..1502 | Exon (1) | 1..4087 | Exon (2) | 1..4087 |
| Translation | MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQ
WITALSHGGGGGGGGGGGGGGGGGGGGGDGSPWSTSPLGQPDIKPSVVVQQGGRGDELHG
PGALQQQHQQQQQQQQQQQQQQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLPPS
MGASNGGLLYSQPSFTVNGMLGAGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPP
PPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYG
NVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTS
IEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLP
GAEDVYGGSRDTPPHHGVQTPVQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 359 | + | a, c | dbSNP:17854693 |
| 789 | + | c, t | dbSNP:17854694 |
| complement(797) | - | c, a | dbSNP:195860 |
| 1031 | + | a, c | dbSNP:17854695 |
| 1641 | + | a, c | dbSNP:111620909 |
| 1641 | + | , c | dbSNP:71545770 |
| 1867..1868 | + | , a | dbSNP:34400185 |
| 1912 | + | c, t | dbSNP:79339339 |
| complement(1953) | - | g, a | dbSNP:3823036 |
| 1961..1962 | + | , c | dbSNP:34587175 |
| 2187 | + | c, t | dbSNP:112324835 |
| 2405 | + | c, g | dbSNP:33999841 |
| 2452 | + | a, g | dbSNP:9398940 |
| 2640 | + | c, t | dbSNP:12665323 |
| 2649 | + | c, t | dbSNP:77971107 |
| 2734..2735 | + | , t | dbSNP:57487121 |
| 2980 | + | , a | dbSNP:67903047 |
| 2989 | + | , a | dbSNP:66591282 |
| 2990 | + | , a | dbSNP:5878562 |
| 3049 | + | c, t | dbSNP:79872709 |
| 3057 | + | a, g | dbSNP:66683016 |
| 3107 | + | a, g | dbSNP:62423591 |
| 3191 | + | a, g | dbSNP:113027329 |
| 3404..3405 | + | , c | dbSNP:34463125 |
| 3496 | + | c, t | dbSNP:73501598 |
| 3575 | + | a, c | dbSNP:115885987 |
| 3795..3796 | + | , t | dbSNP:66634163 |
| 4082 | + | a, t | dbSNP:77120481 |
| Gene Symbol | POU3F2 |
| Gene Synonym | BRN2; OCT7; OTF7; POUF3 |
| Chromosome | 6 |
| Locus Map | 6q16 |
| All Transcripts | NM_005604 |
| Title | Genome-wide analysis of POU3F2/BRN2 promoter occupancy in human melanoma cells reveals Kitl as a novel regulated target gene . |
| Author | Kobi,D., Steunou,A.L., Dembele,D., Legras,S., Larue,L., Nieto,L. and Davidson,I. |
| Journal | Pigment Cell Melanoma Res 23 (3), 404-418 (2010) |
| Title | SOX9 and SOX10 but not BRN2 are required for nestin expression in human melanoma cells . |
| Author | Flammiger,A., Besch,R., Cook,A.L., Maier,T., Sturm,R.A. and Berking,C. |
| Journal | J. Invest. Dermatol. 129 (4), 945-953 (2009) |
| Title | Expression and purification of human full-length N Oct-3, a transcription factor involved in melanoma growth . |
| Author | Cabos-Siguier,B., Steunou,A.L., Joseph,G., Alazard,R., Ducoux-Petit,M., Nieto,L., Monsarrat,B., Erard,M. and Clottes,E. |
| Journal | Protein Expr. Purif. 64 (1), 39-46 (2009) |
| Title | A genome-wide association study of schizophrenia using brain activation as a quantitative phenotype . |
| Author | Potkin,S.G., Turner,J.A., Guffanti,G., Lakatos,A., Fallon,J.H., Nguyen,D.D., Mathalon,D., Ford,J., Lauriello,J. and Macciardi,F. |
| Journal | Schizophr Bull 35 (1), 96-108 (2009) |
| Title | Brn-2 represses microphthalmia-associated transcription factor expression and marks a distinct subpopulation of microphthalmia-associated transcription factor-negative melanoma cells . |
| Author | Goodall,J., Carreira,S., Denat,L., Kobi,D., Davidson,I., Nuciforo,P., Sturm,R.A., Larue,L. and Goding,C.R. |
| Journal | Cancer Res. 68 (19), 7788-7794 (2008) |
| Title | The POU domain transcription factor Brn-2: elevated expression in malignant melanoma and regulation of melanocyte-specific gene expression . |
| Author | Eisen,T., Easty,D.J., Bennett,D.C. and Goding,C.R. |
| Journal | Oncogene 11 (10), 2157-2164 (1995) |
| Title | Isolation of the human genomic brain-2/N-Oct 3 gene (POUF3) and assignment to chromosome 6q16 . |
| Author | Atanasoski,S., Toldo,S.S., Malipiero,U., Schreiber,E., Fries,R. and Fontana,A. |
| Journal | Genomics 26 (2), 272-280 (1995) |
| Title | Structure and evolution of four POU domain genes expressed in mouse brain . |
| Author | Hara,Y., Rovescalli,A.C., Kim,Y. and Nirenberg,M. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 89 (8), 3280-3284 (1992) |
| Title | Astrocytes and glioblastoma cells express novel octamer-DNA binding proteins distinct from the ubiquitous Oct-1 and B cell type Oct-2 proteins . |
| Author | Schreiber,E., Harshman,K., Kemler,I., Malipiero,U., Schaffner,W. and Fontana,A. |
| Journal | Nucleic Acids Res. 18 (18), 5495-5503 (1990) |
| Title | Expression of a large family of POU-domain regulatory genes in mammalian brain development . |
| Author | He,X., Treacy,M.N., Simmons,D.M., Ingraham,H.A., Swanson,L.W. and Rosenfeld,M.G. |
| Journal | Nature 340 (6228), 35-41 (1989) |
| Title | Expression of a large family of POU-domain regulatory genes in mammalian brain development . |
| Author | He,X., Treacy,M.N., Simmons,D.M., Ingraham,H.A., Swanson,L.W. and Rosenfeld,M.G. |
| Journal | Nature 340 (6228), 35-41 (1989) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |