• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens POU class 3 homeobox 2 (POU3F2), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu10724 Homo sapiens POU class 3 homeobox 2 (POU3F2), mRNA. pcDNA3.1+-DYK On-demand TBD TBD
OHu10724C Homo sapiens POU class 3 homeobox 2 (POU3F2), mRNA. Customized vector On-demand $269.00 TBD

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_005604.3, 380254475
Length 1332 bp
Structure linear
Update Date 16-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens POU class 3 homeobox 2 (POU3F2), mRNA.
Product POU domain, class 3, transcription factor 2
Comment

Summary: This gene encodes a member of the POU-III class of neural transcription factors. The encoded protein is involved in neuronal differentiation and enhances the activation of corticotropin-releasing hormone regulated genes. Overexpression of this protein is associated with an increase in the proliferation of melanoma cells. [provided by RefSeq, Mar 2012].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_005595.2
CDS 171..1502
Misc Feature(1)6..8
Misc Feature(2)954..1178
Misc Feature(3)954..1178
Misc Feature(4)1191..1193
Misc Feature(5)1233..1406
Misc Feature(6)order(1233..1247,1251..1253,1302..1304,1320..1322,
Misc Feature(7)order(1239..1241,1248..1250,1368..1370,1377..1382,
Exon (1)1..4087
Gene:POU3F2
Gene Synonym:brn-2; BRN2; N-Oct3; oct-7; OCT7; OTF-7; OTF7; POUF3
Translation MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQ WITALSHGGGGGGGGGGGGGGGGGGGGGDGSPWSTSPLGQPDIKPSVVVQQGGRGDELHG PGALQQQHQQQQQQQQQQQQQQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLPPS MGASNGGLLYSQPSFTVNGMLGAGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPP PPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYG NVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTS IEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLP GAEDVYGGSRDTPPHHGVQTPVQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
1+dbSNP:
1+a, cdbSNP:186667950
157+a, cdbSNP:367580619
159+c, gdbSNP:200105737
180+a, gdbSNP:201781902
223+a, tdbSNP:371461013
314+a, gdbSNP:199873673
359+a, cdbSNP:17854693
572+a, gdbSNP:367612148
789+c, tdbSNP:17854694
797+a, cdbSNP:195860
845+c, tdbSNP:369383182
885..893+, ccgccgcccdbSNP:371685985
942+c, gdbSNP:371856505
1031+a, cdbSNP:17854695
1112+a, gdbSNP:147437170
1187+a, gdbSNP:200105843
1226+g, tdbSNP:377608434
1430+g, tdbSNP:369811680
1437+a, gdbSNP:373306906
1481+c, gdbSNP:376966559
1539+c, tdbSNP:202224147
1641..1642+, adbSNP:199735616
1641+a, cdbSNP:111620909
1641+, cdbSNP:71545770
1665+a, gdbSNP:375953848
1730+a, gdbSNP:192443961
1808+c, gdbSNP:183346230
1867..1868+, adbSNP:34400185
1912+c, tdbSNP:79339339
complement(1953)-g, adbSNP:3823036
1961..1962+, cdbSNP:34587175
2187+c, tdbSNP:112324835
2202+c, tdbSNP:187647254
2405+c, gdbSNP:33999841
2408+a, cdbSNP:377168368
2418+a, gdbSNP:138126958
2452+a, gdbSNP:9398940
2640+c, tdbSNP:12665323
2649+c, tdbSNP:77971107
2696+a, gdbSNP:191299683
2725..2726+, tdbSNP:200874161
2734..2735+, tdbSNP:57487121
2940+a, cdbSNP:150077448
2980+, adbSNP:5878562
complement(3007)-t, adbSNP:138384155
3049+c, tdbSNP:79872709
3057+a, gdbSNP:66683016
3107+a, gdbSNP:62423591
complement(3142)-t, cdbSNP:144504012
3191+a, gdbSNP:113027329
3214+a, tdbSNP:182079068
3236+g, tdbSNP:187177491
3370+c, tdbSNP:192631653
3404..3405+, cdbSNP:34463125
3496+c, tdbSNP:73501598
3518+c, tdbSNP:375972837
3554+a, gdbSNP:185412225
3587+a, gdbSNP:190040379
3823+c, tdbSNP:193052910
4082+a, tdbSNP:77120481
Gene SymbolPOU3F2
Gene Synonymbrn-2; BRN2; N-Oct3; oct-7; OCT7; OTF-7; OTF7; POUF3
Chromosome6
Locus Map6q16
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005604 Homo sapiens POU class 3 homeobox 2 (POU3F2), mRNA. On-demand TBD TBD
Title Drug-gene interactions and the search for missing heritability: a cross-sectional pharmacogenomics study of the QT interval .
Author Avery CL, Sitlani CM, Arking DE, Arnett DK, Bis JC, Boerwinkle E, Buckley BM, Ida Chen YD, de Craen AJ, Eijgelsheim M, Enquobahrie D, Evans DS, Ford I, Garcia ME, Gudnason V, Harris TB, Heckbert SR, Hochner H, Hofman A, Hsueh WC, Isaacs A, Jukema JW, Knekt P, Kors JA, Krijthe BP, Kristiansson K, Laaksonen M, Liu Y, Li X, Macfarlane PW, Newton-Cheh C, Nieminen MS, Oostra BA, Peloso GM, Porthan K, Rice K, Rivadeneira FF, Rotter JI, Salomaa V, Sattar N, Siscovick DS, Slagboom PE, Smith AV, Sotoodehnia N, Stott DJ, Stricker BH, Sturmer T, Trompet S, Uitterlinden AG, van Duijn C, Westendorp RG, Witteman JC, Whitsel EA and Psaty BM.
Journal Pharmacogenomics J. 14 (1), 6-13 (2014)
Title Neural lineage-specific homeoprotein BRN2 is directly involved in TTF1 expression in small-cell lung cancer .
Author Sakaeda M, Sato H, Ishii J, Miyata C, Kamma H, Shishido-Hara Y, Shimoyamada H, Fujiwara M, Endo T, Tanaka R, Kondo H, Goya T, Aoki
Journal Lab. Invest. 93 (4), 408-421 (2013)
Title POU domain transcription factor BRN2 is crucial for expression of ASCL1, ND1 and neuroendocrine marker molecules and cell growth in small cell lung cancer .
Author Ishii J, Sato H, Sakaeda M, Shishido-Hara Y, Hiramatsu C, Kamma H, Shimoyamada H, Fujiwara M, Endo T, Aoki I and Yazawa T.
Journal Pathol. Int. 63 (3), 158-168 (2013)
Title Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population .
Author Comuzzie AG, Cole SA, Laston SL, Voruganti VS, Haack K, Gibbs RA and Butte NF.
Journal PLoS ONE 7 (12), E51954 (2012)
Title The POU domain transcription factor Brn-2: elevated expression in malignant melanoma and regulation of melanocyte-specific gene expression .
Author Eisen T, Easty DJ, Bennett DC and Goding CR.
Journal Oncogene 11 (10), 2157-2164 (1995)
Title Isolation of the human genomic brain-2/N-Oct 3 gene (POUF3) and assignment to chromosome 6q16 .
Author Atanasoski S, Toldo SS, Malipiero U, Schreiber E, Fries R and Fontana A.
Journal Genomics 26 (2), 272-280 (1995)
Title cDNA cloning of human N-Oct3, a nervous-system specific POU domain transcription factor binding to the octamer DNA motif .
Author Schreiber E, Tobler A, Malipiero U, Schaffner W and Fontana A.
Journal Nucleic Acids Res. 21 (2), 253-258 (1993)
Title Structure and evolution of four POU domain genes expressed in mouse brain .
Author Hara Y, Rovescalli AC, Kim Y and Nirenberg M.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (8), 3280-3284 (1992)
Title Astrocytes and glioblastoma cells express novel octamer-DNA binding proteins distinct from the ubiquitous Oct-1 and B cell type Oct-2 proteins .
Author Schreiber E, Harshman K, Kemler I, Malipiero U, Schaffner W and Fontana A.
Journal Nucleic Acids Res. 18 (18), 5495-5503 (1990)
Title Expression of a large family of POU-domain regulatory genes in mammalian brain development .
Author He X, Treacy MN, Simmons DM, Ingraham HA, Swanson LW and Rosenfeld MG.
Journal Nature 340 (6228), 35-41 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.