• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens POU class 3 homeobox 2 (POU3F2), mRNA.


RefSeq Accession Definition Services Price Order
NM_005604 Homo sapiens POU class 3 homeobox 2 (POU3F2), mRNA. ORF Sequence $386.28
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_005604.3, 380254475
Length 4108 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens POU class 3 homeobox 2 (POU3F2), mRNA.
Product POU domain, class 3, transcription factor 2
Comment

Summary: This gene encodes a member of the POU-III class of neural transcription factors. The encoded protein is involved in neuronal differentiation and enhances the activation of corticotropin-releasing hormone regulated genes. Overexpression of this protein is associated with an increase in the proliferation of melanoma cells. [provided by RefSeq, Mar 2012].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_005595.2
CDS 171..1502
Misc Feature(1)6..8
Misc Feature(2)954..1178
Misc Feature(3)954..1178
Misc Feature(4)1191..1193
Misc Feature(5)1233..1406
Misc Feature(6)order(1233..1247,1251..1253,1302..1304,1320..1322,
Misc Feature(7)order(1239..1241,1248..1250,1368..1370,1377..1382,
Exon (1)1..4087
Gene:POU3F2
Gene Synonym:brn-2; BRN2; N-Oct3; oct-7; OCT7; OTF-7; OTF7; POUF3
Translation MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQ WITALSHGGGGGGGGGGGGGGGGGGGGGDGSPWSTSPLGQPDIKPSVVVQQGGRGDELHG PGALQQQHQQQQQQQQQQQQQQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLPPS MGASNGGLLYSQPSFTVNGMLGAGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPP PPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYG NVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTS IEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLP GAEDVYGGSRDTPPHHGVQTPVQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
1+dbSNP:
1+a, cdbSNP:186667950
159+c, gdbSNP:200105737
180+a, gdbSNP:201781902
314+a, gdbSNP:199873673
359+a, cdbSNP:17854693
789+c, tdbSNP:17854694
797+a, cdbSNP:195860
1031+a, cdbSNP:17854695
1112+a, gdbSNP:147437170
1187+a, gdbSNP:200105843
1539+c, tdbSNP:202224147
1641..1642+, adbSNP:201689155
1641+a, cdbSNP:111620909
1641+, cdbSNP:71545770
1649..1650+, adbSNP:199735616
1730+a, gdbSNP:192443961
1808+c, gdbSNP:183346230
1867..1868+, adbSNP:34400185
1912+c, tdbSNP:79339339
1953+a, gdbSNP:3823036
1959..1960+, cdbSNP:34587175
2187+c, tdbSNP:112324835
2202+c, tdbSNP:187647254
2405+c, gdbSNP:33999841
2418+a, gdbSNP:138126958
2452+a, gdbSNP:9398940
2640+c, tdbSNP:12665323
2649+c, tdbSNP:77971107
2696+a, gdbSNP:191299683
2725..2726+, tdbSNP:200874161
2726..2727+, tdbSNP:57487121
2940+a, cdbSNP:150077448
2980+, adbSNP:5878562
3007+a, tdbSNP:138384155
3049+c, tdbSNP:79872709
3057+a, gdbSNP:66683016
3107+a, gdbSNP:62423591
3142+c, tdbSNP:144504012
3191+a, gdbSNP:113027329
3214+a, tdbSNP:182079068
3236+g, tdbSNP:187177491
3370+c, tdbSNP:192631653
3403..3404+, cdbSNP:34463125
3496+c, tdbSNP:73501598
3554+a, gdbSNP:185412225
3587+a, gdbSNP:190040379
3795..3796+, tdbSNP:66634163
3823+c, tdbSNP:193052910
4082+a, tdbSNP:77120481
Gene SymbolPOU3F2
Gene Synonymbrn-2; BRN2; N-Oct3; oct-7; OCT7; OTF-7; OTF7; POUF3
Chromosome6
Locus Map6q16
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_005604 Homo sapiens POU class 3 homeobox 2 (POU3F2), mRNA. Full Length $1437.80
ORF Sequence $386.28
Title BRN2 is a transcriptional repressor of CDH13 (T-cadherin) in melanoma cells .
Author Ellmann,L., Joshi,M.B., Resink,T.J., Bosserhoff,A.K. and Kuphal,S.
Journal Lab. Invest. 92 (12), 1788-1800 (2012)
Title A phosphatidylinositol 3-kinase-Pax3 axis regulates Brn-2 expression in melanoma .
Author Bonvin,E., Falletta,P., Shaw,H., Delmas,V. and Goding,C.R.
Journal Mol. Cell. Biol. 32 (22), 4674-4683 (2012)
Title Inverse expression states of the BRN2 and MITF transcription factors in melanoma spheres and tumour xenografts regulate the .
Author Thurber,A.E., Douglas,G., Sturm,E.C., Zabierowski,S.E., Smit,D.J., Ramakrishnan,S.N., Hacker,E., Leonard,J.H., Herlyn,M. and Sturm,R.A.
Journal Oncogene 30 (27), 3036-3048 (2011)
Title Melanoma cell invasiveness is regulated by miR-211 suppression of the BRN2 transcription factor .
Author Boyle,G.M., Woods,S.L., Bonazzi,V.F., Stark,M.S., Hacker,E., Aoude,L.G., Dutton-Regester,K., Cook,A.L., Sturm,R.A. and Hayward,N.K.
Journal Pigment Cell Melanoma Res 24 (3), 525-537 (2011)
Title The POU domain transcription factor Brn-2: elevated expression in malignant melanoma and regulation of melanocyte-specific gene expression .
Author Eisen,T., Easty,D.J., Bennett,D.C. and Goding,C.R.
Journal Oncogene 11 (10), 2157-2164 (1995)
Title Isolation of the human genomic brain-2/N-Oct 3 gene (POUF3) and assignment to chromosome 6q16 .
Author Atanasoski,S., Toldo,S.S., Malipiero,U., Schreiber,E., Fries,R. and Fontana,A.
Journal Genomics 26 (2), 272-280 (1995)
Title cDNA cloning of human N-Oct3, a nervous-system specific POU domain transcription factor binding to the octamer DNA motif .
Author Schreiber,E., Tobler,A., Malipiero,U., Schaffner,W. and Fontana,A.
Journal Nucleic Acids Res. 21 (2), 253-258 (1993)
Title Structure and evolution of four POU domain genes expressed in mouse brain .
Author Hara,Y., Rovescalli,A.C., Kim,Y. and Nirenberg,M.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (8), 3280-3284 (1992)
Title Astrocytes and glioblastoma cells express novel octamer-DNA binding proteins distinct from the ubiquitous Oct-1 and B cell type Oct-2 proteins .
Author Schreiber,E., Harshman,K., Kemler,I., Malipiero,U., Schaffner,W. and Fontana,A.
Journal Nucleic Acids Res. 18 (18), 5495-5503 (1990)
Title Expression of a large family of POU-domain regulatory genes in mammalian brain development .
Author He,X., Treacy,M.N., Simmons,D.M., Ingraham,H.A., Swanson,L.W. and Rosenfeld,M.G.
Journal Nature 340 (6228), 35-41 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878