• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens RNA binding motif protein 10 (RBM10), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu26867 Homo sapiens RNA binding motif protein 10 (RBM10), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu26867C Homo sapiens RNA binding motif protein 10 (RBM10), transcript variant 1, mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_005676.4, 325120979
Length 2793 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens RNA binding motif protein 10 (RBM10), transcript variant 1, mRNA.
Product RNA-binding protein 10 isoform 1
Comment

Summary: This gene encodes a nuclear protein that belongs to a family proteins that contain an RNA-binding motif. The encoded protein associates with hnRNP proteins and may be involved in regulating alternative splicing. Defects in this gene are the cause of the X-linked recessive disorder, TARP syndrome. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Mar 2011].


Transcript Variant: This variant (1) encodes isoform (1).

RefSeq NP_005667.2
CDS 394..3186
Misc Feature(1)55..57
Misc Feature(2)55..57
Misc Feature(3)454..>1089
Misc Feature(4)454..>1089
Misc Feature(5)541..543
Misc Feature(6)571..573
Misc Feature(7)574..576
Misc Feature(8)658..660
Misc Feature(9)658..660
Misc Feature(10)664..666
Misc Feature(11)772..1026
Misc Feature(12)1036..1110
Misc Feature(13)1255..1257
Misc Feature(14)1285..1545
Misc Feature(15)1540..1542
Misc Feature(16)1942..1944
Misc Feature(17)2545..2547
Misc Feature(18)2560..2562
Misc Feature(19)2560..2562
Misc Feature(20)2587..2589
Misc Feature(21)2590..2592
Misc Feature(22)2590..2592
Misc Feature(23)2599..2601
Misc Feature(24)2599..2601
Misc Feature(25)2605..2607
Misc Feature(26)2605..2607
Misc Feature(27)2605..2607
Misc Feature(28)2734..2736
Misc Feature(29)2782..2784
Misc Feature(30)2782..2784
Misc Feature(31)2968..3099
Exon (1)1..268
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (2)269..410
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (3)411..594
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (4)595..825
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (5)826..895
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (6)896..969
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (7)970..1056
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (8)1057..1117
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (9)1118..1294
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (10)1295..1455
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (11)1456..1553
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (12)1554..1641
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (13)1642..1828
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (14)1829..1968
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (15)1969..2086
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (16)2087..2178
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (17)2179..2343
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (18)2344..2493
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (19)2494..2559
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (20)2560..2748
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (21)2749..2823
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (22)2824..2930
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (23)2931..3060
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Exon (24)3061..3402
Gene:RBM10
Gene Synonym:DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Translation MEYERRGGRGDRTGRYGATDRSQDDGGENRSRDHDYRDMDYRSYPREYGSQEGKHDYDDS SEEQSAEDSYEASPGSETQRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEED EEEEEKASNIVMLRMLPQAATEDDIRGQLQSHGVQAREVRLMRNKSSGQSRGFAFVEFSH LQDATRWMEANQHSLNILGQKVSMHYSDPKPKINEDWLCNKCGVQNFKRREKCFKCGVPK SEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENAND TIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIVEAAQLL QILQALHPPLTIDGKTINVEFAKGSKRDMASNEGSRISAASVASTAIAAAQWAISQASQG GEGTWATSEEPPVDYSYYQQDEGYGNSQGTESSLYAHGYLKGTKGPGITGTKGDPTGAGP EASLEPGADSVSMQAFSRAQPGAAPGIYQQSAEASSSQGTAANSQSYTIMSPAVLKSELQ SPTHPSSALPPATSPTAQESYSQYPVPDVSTYQYDETSGYYYDPQTGLYYDPNSQYYYNA QSQQYLYWDGERRTYVPALEQSADGHKETGAPSKEGKEKKEKHKTKTAQQIAKDMERWAR SLNKQKENFKNSFQPISSLRDDERRESATADAGYAILEKKGALAERQHTSMDLPKLASDD RPSPPRGLVAAYSGESDSEEEQERGGPEREEKLTDWQKLACLLCRRQFPSKEALIRHQQL SGLHKQNLEIHRRAHLSENELEALEKNDMEQMKYRDRAAERREKYGIPEPPEPKRRKYGG ISTASVDFEQPTRDGLGSDNIGSRMLQAMGWKEGSGLGRKKQGIVTPIEAQTRVRGSGLG ARGSSYGVTSTESYKETLHKTMVTRFNEAQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
141+g, tdbSNP:181770538
222+c, tdbSNP:12008422
245+c, tdbSNP:5952419
366+dbSNP:
366+c, tdbSNP:377020288
390+c, gdbSNP:75445510
468+dbSNP:
468+c, tdbSNP:200766225
492+c, tdbSNP:368193449
495+c, tdbSNP:200208681
502..503+, gdbSNP:34164525
517+c, tdbSNP:370571712
567+c, tdbSNP:374011478
621+dbSNP:
621+c, gdbSNP:368904095
647+a, gdbSNP:139829599
654+a, gdbSNP:184096287
667+a, gdbSNP:372162654
708+a, gdbSNP:375054626
753+g, tdbSNP:377667483
853+dbSNP:
853+a, gdbSNP:369088033
957+dbSNP:
957+a, gdbSNP:202102038
1011+dbSNP:
1011+a, cdbSNP:12852407
1140+dbSNP:
1140+c, tdbSNP:143244180
1166+c, tdbSNP:140296609
1362+dbSNP:
1362+c, tdbSNP:149920057
1386+c, gdbSNP:145036791
1422+c, tdbSNP:199835845
1468+dbSNP:
1468+c, tdbSNP:376098588
1497+a, gdbSNP:149109733
1568+dbSNP:
1568+a, gdbSNP:189102912
1609..1610+, cdbSNP:34179743
1623+c, gdbSNP:201959656
1628+a, gdbSNP:267607000
1662+dbSNP:
1662+c, tdbSNP:143203694
complement(1685)-t, cdbSNP:11551150
1686+a, gdbSNP:139013965
1740+c, tdbSNP:375874025
1838+dbSNP:
1838+c, gdbSNP:147041092
1857+c, tdbSNP:373200898
1861+c, tdbSNP:112632964
1869+a, gdbSNP:138358884
1904+c, tdbSNP:376646619
1929+c, tdbSNP:143917116
1933+a, gdbSNP:200884733
1935+a, gdbSNP:370783292
1993+dbSNP:
1993+a, gdbSNP:182619972
1995+a, gdbSNP:150665564
complement(2059)-t, cdbSNP:11551151
2059+c, tdbSNP:386519075
2062+a, gdbSNP:372639150
2089+dbSNP:
2089+a, gdbSNP:138911533
2115+c, tdbSNP:375207660
2127+a, cdbSNP:369261759
2151+c, tdbSNP:112102343
2163+c, tdbSNP:200978989
2193+dbSNP:
2193+c, tdbSNP:200977401
2234+c, tdbSNP:373311677
2244+c, tdbSNP:376595614
2262+c, tdbSNP:187986081
2265+c, tdbSNP:369579896
2284+c, gdbSNP:79693964
2288+a, cdbSNP:200120271
2292+a, gdbSNP:201100351
2402+dbSNP:
2402+a, gdbSNP:200347455
2439+c, tdbSNP:370518602
2499+dbSNP:
2499+a, gdbSNP:139770717
2534+c, tdbSNP:143128508
2567+dbSNP:
2567+c, tdbSNP:375052241
2568+g, tdbSNP:137940243
2580+a, gdbSNP:189725339
2592+c, tdbSNP:146185615
2772+dbSNP:
2772+a, cdbSNP:367680909
2790+c, tdbSNP:372362761
2868+dbSNP:
2868+c, tdbSNP:200535931
2877+c, tdbSNP:139148914
2910+c, tdbSNP:373176484
2915+c, tdbSNP:142585482
2928+c, tdbSNP:150979807
2955+dbSNP:
2955+c, tdbSNP:139585263
2983+a, cdbSNP:373519623
3049+a, gdbSNP:112560260
3057+c, gdbSNP:377461139
3063+dbSNP:
3063+c, tdbSNP:149725208
3098+a, gdbSNP:190398066
3148+c, tdbSNP:202039165
3174+c, tdbSNP:368225286
3231+g, tdbSNP:200521605
3262+c, gdbSNP:181900691
3270+a, cdbSNP:41303207
Gene SymbolRBM10
Gene SynonymDXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
ChromosomeX
Locus MapXp11.23
Title RBM10 regulates alternative splicing .
Author Inoue A, Yamamoto N, Kimura M, Nishio K, Yamane H and Nakajima K.
Journal FEBS Lett. 588 (6), 942-947 (2014)
Title RBM5, 6, and 10 differentially regulate NUMB alternative splicing to control cancer cell proliferation .
Author Bechara EG, Sebestyen E, Bernardis I, Eyras E and Valcarcel J.
Journal Mol. Cell 52 (5), 720-733 (2013)
Title Integrative analysis revealed the molecular mechanism underlying RBM10-mediated splicing regulation .
Author Wang Y, Gogol-Doring A, Hu H, Frohler S, Ma Y, Jens M, Maaskola J, Murakawa Y, Quedenau C, Landthaler M, Kalscheuer V, Wieczorek D, Wang Y, Hu Y and Chen W.
Journal EMBO Mol Med 5 (9), 1431-1442 (2013)
Title S1-1/RBM10: multiplicity and cooperativity of nuclear localisation domains .
Author Xiao SJ, Wang LY, Kimura M, Kojima H, Kunimoto H, Nishiumi F, Yamamoto N, Nishio K, Fujimoto S, Kato T, Kitagawa S, Yamane H, Nakajima K and Inoue A.
Journal Biol. Cell 105 (4), 162-174 (2013)
Title Massively parallel sequencing of exons on the X chromosome identifies RBM10 as the gene that causes a syndromic form of cleft palate .
Author Johnston JJ, Teer JK, Cherukuri PF, Hansen NF, Loftus SK, Chong K, Mullikin JC and Biesecker LG.
Journal Am. J. Hum. Genet. 86 (5), 743-748 (2010)
Title Positive correlation between the expression of X-chromosome RBM genes (RBMX, RBM3, RBM10) and the proapoptotic Bax gene in human breast cancer .
Author Martinez-Arribas F, Agudo D, Pollan M, Gomez-Esquer F, Diaz-Gil G, Lucas R and Schneider J.
Journal J. Cell. Biochem. 97 (6), 1275-1282 (2006)
Title An integrated, functionally annotated gene map of the DXS8026-ELK1 interval on human Xp11.3-Xp11.23: potential hotspot for neurogenetic disorders .
Author Thiselton DL, McDowall J, Brandau O, Ramser J, d'Esposito F, Bhattacharya SS, Ross MT, Hardcastle AJ and Meindl A.
Journal Genomics 79 (4), 560-572 (2002)
Title Molecular cloning of a RNA binding protein, S1-1 .
Author Inoue A, Takahashi KP, Kimura M, Watanabe T and Morisawa S.
Journal Nucleic Acids Res. 24 (15), 2990-2997 (1996)
Title A novel gene, DXS8237E, lies within 20 kb upstream of UBE1 in Xp11.23 and has a different X inactivation status .
Author Coleman MP, Ambrose HJ, Carrel L, Nemeth AH, Willard HF and Davies KE.
Journal Genomics 31 (1), 135-138 (1996)
Title Robin's syndrome. A probably X-linked recessive subvariety exhibiting persistence of left superior vena cava and atrial septal defect .
Author Gorlin,R.J., Cervenka,J., Anderson,R.C., Sauk,J.J. and Bevis,W.D.
Journal Am. J. Dis. Child. 119 (2), 176-178 (1970)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.