• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens EGF-like repeats and discoidin I-like domains 3 (EDIL3), mRNA.


RefSeq Accession Definition Services Price Order
NM_005711 Homo sapiens EGF-like repeats and discoidin I-like domains 3 (EDIL3), mRNA. ORF Sequence $418.47
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_005711.3, 31317223
Length 2974 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens EGF-like repeats and discoidin I-like domains 3 (EDIL3), mRNA.
Product EGF-like repeat and discoidin I-like domain-containing protein 3
Comment

Summary: The protein encoded by this gene is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior. [provided by RefSeq, Jul 2008].

RefSeq NP_005702.3
CDS 420..1862
Misc Feature(1)321..323
Misc Feature(2)498..596
Misc Feature(3)498..596
Misc Feature(4)654..770
Misc Feature(5)705..713
Misc Feature(6)774..884
Misc Feature(7)order(774..776,783..785,825..827)
Misc Feature(8)888..1361
Misc Feature(9)897..1358
Misc Feature(10)order(1035..1037,1119..1121,1140..1142)
Misc Feature(11)1371..1847
Misc Feature(12)1380..1844
Misc Feature(13)order(1521..1523,1605..1607,1626..1628)
Exon (1)1..486
Gene:EDIL3
Gene Synonym:DEL1
Exon (2)487..615
Gene:EDIL3
Gene Synonym:DEL1
Exon (3)616..645
Gene:EDIL3
Gene Synonym:DEL1
Exon (4)646..774
Gene:EDIL3
Gene Synonym:DEL1
Exon (5)775..888
Gene:EDIL3
Gene Synonym:DEL1
Exon (6)889..1070
Gene:EDIL3
Gene Synonym:DEL1
Exon (7)1071..1226
Gene:EDIL3
Gene Synonym:DEL1
Exon (8)1227..1371
Gene:EDIL3
Gene Synonym:DEL1
Exon (9)1372..1556
Gene:EDIL3
Gene Synonym:DEL1
Exon (10)1557..1712
Gene:EDIL3
Gene Synonym:DEL1
Exon (11)1713..2974
Gene:EDIL3
Gene Synonym:DEL1
Translation MKRSVAVWLLVGLSLGVPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCS SVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNI NECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTH RALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSP EYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQV CRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDK QGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWT VYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(66)-dbSNP:
complement(66)-c, adbSNP:191242390
complement(383)-g, adbSNP:112586454
complement(492)-dbSNP:
complement(492)-t, cdbSNP:142764044
complement(525)-t, cdbSNP:202019618
complement(538)-t, cdbSNP:201433954
complement(539)-t, cdbSNP:148512641
complement(544)-g, adbSNP:187211570
complement(604)-g, adbSNP:201038512
complement(731)-dbSNP:
complement(731)-g, adbSNP:151132765
complement(810)-dbSNP:
complement(810)-t, cdbSNP:200637689
complement(860)-g, adbSNP:58219060
complement(955)-dbSNP:
complement(955)-g, adbSNP:139568125
complement(993)-t, adbSNP:146011995
complement(1153)-dbSNP:
complement(1153)-g, adbSNP:113327336
complement(1156)-t, adbSNP:142572382
complement(1184)-g, cdbSNP:138920492
complement(1242)-dbSNP:
complement(1242)-t, cdbSNP:199553930
complement(1247)-g, adbSNP:199498652
complement(1252)-t, cdbSNP:146217388
complement(1256)-c, adbSNP:141141498
complement(1259)-t, cdbSNP:148201117
complement(1275)-t, gdbSNP:201386908
complement(1284)-t, cdbSNP:192448414
complement(1307)-g, cdbSNP:201445443
complement(1364)-t, cdbSNP:143816596
complement(1367)-c, adbSNP:78529501
complement(1369..1370)-t, cdbSNP:17854833
complement(1369)-g, adbSNP:188169797
complement(1370)-t, cdbSNP:2269287
complement(1385)-dbSNP:
complement(1385)-c, adbSNP:147149050
complement(1410)-g, cdbSNP:142557706
complement(1422)-t, cdbSNP:200153619
complement(1449)-g, adbSNP:200488576
complement(1484)-t, cdbSNP:147685138
complement(1488)-g, adbSNP:116620560
complement(1529)-g, adbSNP:150438906
complement(1531)-t, adbSNP:200752338
complement(1557)-dbSNP:
complement(1557)-t, cdbSNP:140436608
complement(1563)-g, adbSNP:28590009
complement(1583)-t, cdbSNP:201245990
complement(1729)-dbSNP:
complement(1729)-c, adbSNP:201681404
complement(1736)-g, adbSNP:199597050
complement(1754)-g, adbSNP:151261093
complement(1851)-g, cdbSNP:149764869
complement(1951)-c, adbSNP:62364163
complement(1952..1953)-, adbSNP:201546691
complement(1967)-, adbSNP:146077789
complement(1980)-g, adbSNP:111566312
complement(2064)-g, adbSNP:112770614
complement(2070)-t, cdbSNP:186163750
complement(2141)-t, cdbSNP:182081090
complement(2188)-t, gdbSNP:191948621
complement(2284)-t, cdbSNP:187630047
complement(2377)-t, gdbSNP:73141978
complement(2454)-g, cdbSNP:139780489
complement(2517..2518)-, adbSNP:71689235
complement(2604)-g, adbSNP:12522953
complement(2662)-t, cdbSNP:146565284
complement(2719)-g, adbSNP:1139750
complement(2722)-c, adbSNP:1139751
complement(2730)-t, cdbSNP:180697565
complement(2733)-g, adbSNP:189466208
complement(2864)-g, adbSNP:9293360
complement(2867)-g, adbSNP:10473880
Gene SymbolEDIL3
Gene SynonymDEL1
Chromosome5
Locus Map5q14
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_005711 Homo sapiens EGF-like repeats and discoidin I-like domains 3 (EDIL3), mRNA. Full Length $862.46
ORF Sequence $418.47
Title Role of the endothelial-derived endogenous anti-inflammatory factor Del-1 in inflammation-mediated adrenal gland dysfunction .
Author Kanczkowski,W., Chatzigeorgiou,A., Grossklaus,S., Sprott,D., Bornstein,S.R. and Chavakis,T.
Journal Endocrinology 154 (3), 1181-1189 (2013)
Title The RGD finger of Del-1 is a unique structural feature critical for integrin binding .
Author Schurpf,T., Chen,Q., Liu,J.H., Wang,R., Springer,T.A. and Wang,J.H.
Journal FASEB J. 26 (8), 3412-3420 (2012)
Title Developmental endothelial locus-1 (Del-1) mediates clearance of platelet microparticles by the endothelium .
Author Dasgupta,S.K., Le,A., Chavakis,T., Rumbaut,R.E. and Thiagarajan,P.
Journal Circulation 125 (13), 1664-1672 (2012)
Title A genome-wide association study in Han Chinese identifies new susceptibility loci for ankylosing spondylitis .
Author Lin,Z., Bei,J.X., Shen,M., Li,Q., Liao,Z., Zhang,Y., Lv,Q., Wei,Q., Low,H.Q., Guo,Y.M., Cao,S., Yang,M., Hu,Z., Xu,M., Wang,X., Wei,Y., Li,L., Li,C., Li,T., Huang,J., Pan,Y., Jin,O., Wu,Y., Wu,J., Guo,Z., He,P., Hu,S., Wu,H., Song,H., Zhan,F., Liu,S., Gao,G., Liu,Z., Li,Y., Xiao,C., Li,J., Ye,Z., He,W., Liu,D., Shen,L., Huang,A., Wu,H., Tao,Y., Pan,X., Yu,B., Tai,E.S., Zeng,Y.X., Ren,E.C., Shen,Y., Liu,J. and Gu,J.
Journal Nat. Genet. 44 (1), 73-77 (2012)
Title A genome-wide study reveals copy number variants exclusive to childhood obesity cases .
Author Glessner,J.T., Bradfield,J.P., Wang,K., Takahashi,N., Zhang,H., Sleiman,P.M., Mentch,F.D., Kim,C.E., Hou,C., Thomas,K.A., Garris,M.L., Deliard,S., Frackelton,E.C., Otieno,F.G., Zhao,J., Chiavacci,R.M., Li,M., Buxbaum,J.D., Berkowitz,R.I., Hakonarson,H. and Grant,S.F.
Journal Am. J. Hum. Genet. 87 (5), 661-666 (2010)
Title Chemerin, a novel adipokine in the regulation of angiogenesis .
Author Bozaoglu,K., Curran,J.E., Stocker,C.J., Zaibi,M.S., Segal,D., Konstantopoulos,N., Morrison,S., Carless,M., Dyer,T.D., Cole,S.A., Goring,H.H., Moses,E.K., Walder,K., Cawthorne,M.A., Blangero,J. and Jowett,J.B.
Journal J. Clin. Endocrinol. Metab. 95 (5), 2476-2485 (2010)
Title The ERAP2 gene is associated with preeclampsia in Australian and Norwegian populations .
Author Johnson,M.P., Roten,L.T., Dyer,T.D., East,C.E., Forsmo,S., Blangero,J., Brennecke,S.P., Austgulen,R. and Moses,E.K.
Journal Hum. Genet. 126 (5), 655-666 (2009)
Title The role of adhesion molecules, alpha v beta 3, alpha v beta 5 and their ligands in the tumor cell and endothelial cell adhesion .
Author Niu,J.X., Zhang,W.J., Ye,L.Y., Wu,L.Q., Zhu,G.J., Yang,Z.H., Grau,G.E. and Lou,J.N.
Journal Eur. J. Cancer Prev. 16 (6), 517-527 (2007)
Title The embryonic angiogenic factor Del1 accelerates tumor growth by enhancing vascular formation .
Author Aoka,Y., Johnson,F.L., Penta,K., Hirata Ki,K., Hidai,C., Schatzman,R., Varner,J.A. and Quertermous,T.
Journal Microvasc. Res. 64 (1), 148-161 (2002)
Title Cloning and characterization of developmental endothelial locus-1: an embryonic endothelial cell protein that binds the alphavbeta3 integrin receptor .
Author Hidai,C., Zupancic,T., Penta,K., Mikhail,A., Kawana,M., Quertermous,E.E., Aoka,Y., Fukagawa,M., Matsui,Y., Platika,D., Auerbach,R., Hogan,B.L., Snodgrass,R. and Quertermous,T.
Journal Genes Dev. 12 (1), 21-33 (1998)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878