• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens EGF-like repeats and discoidin I-like domains 3 (EDIL3), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005711 Homo sapiens EGF-like repeats and discoidin I-like domains 3 (EDIL3), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_005711.4, 522023551
Length 4771 bp
Structure linear
Update Date 18-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens EGF-like repeats and discoidin I-like domains 3 (EDIL3), transcript variant 1, mRNA.
Product EGF-like repeat and discoidin I-like domain-containing protein 3 isoform 1 precursor
Comment

Summary: The protein encoded by this gene is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) encodes the longer isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_005702.3
CDS 494..1936
Misc Feature(1)395..397
Misc Feature(2)572..670
Misc Feature(3)728..844
Misc Feature(4)779..787
Misc Feature(5)848..958
Misc Feature(6)order(848..850,857..859,899..901)
Misc Feature(7)971..1432
Misc Feature(8)order(1109..1111,1193..1195,1214..1216)
Misc Feature(9)1454..1918
Misc Feature(10)order(1595..1597,1679..1681,1700..1702)
Exon (1)1..560
Gene:EDIL3
Gene Synonym:DEL1
Exon (2)561..689
Gene:EDIL3
Gene Synonym:DEL1
Exon (3)690..719
Gene:EDIL3
Gene Synonym:DEL1
Exon (4)720..848
Gene:EDIL3
Gene Synonym:DEL1
Exon (5)849..962
Gene:EDIL3
Gene Synonym:DEL1
Exon (6)963..1144
Gene:EDIL3
Gene Synonym:DEL1
Exon (7)1145..1300
Gene:EDIL3
Gene Synonym:DEL1
Exon (8)1301..1445
Gene:EDIL3
Gene Synonym:DEL1
Exon (9)1446..1630
Gene:EDIL3
Gene Synonym:DEL1
Exon (10)1631..1786
Gene:EDIL3
Gene Synonym:DEL1
Exon (11)1787..4760
Gene:EDIL3
Gene Synonym:DEL1
Translation MKRSVAVWLLVGLSLGVPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCS SVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNI NECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTH RALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSP EYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQV CRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDK QGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWT VYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(140)-dbSNP:
complement(140)-c, adbSNP:191242390
complement(433)-c, adbSNP:370448735
complement(456)-g, adbSNP:368416158
complement(457)-g, adbSNP:112586454
complement(480)-g, adbSNP:371486548
complement(523)-c, adbSNP:368047644
complement(566)-dbSNP:
complement(566)-t, cdbSNP:142764044
complement(599)-t, cdbSNP:202019618
complement(612)-t, cdbSNP:201433954
complement(613)-t, cdbSNP:148512641
complement(618)-g, adbSNP:187211570
complement(678)-g, adbSNP:201038512
complement(707)-dbSNP:
complement(707)-g, cdbSNP:376027513
complement(717)-g, adbSNP:373427567
complement(743)-dbSNP:
complement(743)-g, adbSNP:377186598
complement(762)-t, cdbSNP:371740698
complement(805)-g, adbSNP:151132765
complement(809)-t, gdbSNP:367790675
complement(884)-dbSNP:
complement(884)-t, cdbSNP:200637689
complement(934)-g, adbSNP:58219060
complement(935)-t, cdbSNP:375171867
complement(1029)-dbSNP:
complement(1029)-g, adbSNP:139568125
complement(1035)-t, cdbSNP:370618954
complement(1052)-t, gdbSNP:267600722
complement(1067)-t, adbSNP:146011995
complement(1135)-t, cdbSNP:368679977
complement(1227)-dbSNP:
complement(1227)-g, adbSNP:113327336
complement(1230)-t, adbSNP:142572382
complement(1258)-g, cdbSNP:138920492
complement(1272)-t, cdbSNP:376372944
complement(1275)-t, adbSNP:373678779
complement(1291)-g, adbSNP:369491290
complement(1308)-dbSNP:
complement(1308)-t, cdbSNP:368525977
complement(1316)-t, cdbSNP:199553930
complement(1321)-g, adbSNP:199498652
complement(1326)-t, cdbSNP:146217388
complement(1333)-t, cdbSNP:148201117
complement(1349)-t, gdbSNP:201386908
complement(1358)-t, cdbSNP:192448414
complement(1381)-g, cdbSNP:201445443
complement(1438)-t, cdbSNP:143816596
complement(1441)-c, adbSNP:78529501
complement(1443..1444)-t, cdbSNP:17854833
complement(1443)-g, adbSNP:188169797
complement(1444)-t, cdbSNP:2269287
complement(1459)-dbSNP:
complement(1459)-c, adbSNP:147149050
complement(1484)-g, cdbSNP:142557706
complement(1496)-t, cdbSNP:200153619
complement(1523)-g, adbSNP:200488576
complement(1558)-t, cdbSNP:147685138
complement(1562)-g, adbSNP:116620560
complement(1589)-c, adbSNP:368032066
complement(1603)-g, adbSNP:150438906
complement(1605)-t, adbSNP:200752338
complement(1631)-dbSNP:
complement(1631)-t, cdbSNP:140436608
complement(1637)-g, adbSNP:28590009
complement(1655)-t, cdbSNP:368407385
complement(1657)-t, cdbSNP:201245990
complement(1677)-t, cdbSNP:267600721
complement(1738)-g, adbSNP:377140824
complement(1745)-g, adbSNP:374240916
complement(1803)-dbSNP:
complement(1803)-c, adbSNP:201681404
complement(1810)-g, adbSNP:199597050
complement(1828)-g, adbSNP:151261093
complement(1854)-t, cdbSNP:373906150
complement(1872)-g, adbSNP:267600720
complement(1886)-t, cdbSNP:370598359
complement(1925)-g, cdbSNP:149764869
complement(1941)-t, cdbSNP:377681792
complement(1984)-g, adbSNP:369916818
complement(2025)-c, adbSNP:62364163
complement(2026..2027)-, adbSNP:201546691
complement(2041)-, adbSNP:146077789
complement(2054)-g, adbSNP:111566312
complement(2138)-g, adbSNP:112770614
complement(2144)-t, cdbSNP:186163750
complement(2215)-t, cdbSNP:182081090
complement(2262)-t, gdbSNP:191948621
complement(2358)-t, cdbSNP:187630047
complement(2451)-t, gdbSNP:73141978
complement(2528)-g, cdbSNP:139780489
complement(2592)-, adbSNP:374949312
complement(2651)-t, cdbSNP:375575798
complement(2678)-g, adbSNP:12522953
complement(2736)-t, cdbSNP:146565284
2793+a, gdbSNP:1139750
2796+a, cdbSNP:1139751
complement(2804)-t, cdbSNP:180697565
complement(2807)-g, adbSNP:189466208
complement(2887)-t, adbSNP:376580358
complement(2938)-g, adbSNP:9293360
complement(2941)-g, adbSNP:10473880
complement(3085)-t, adbSNP:185354145
complement(3091)-t, gdbSNP:114819029
complement(3253)-t, cdbSNP:112727358
complement(3357)-t, cdbSNP:144284328
complement(3364)-t, cdbSNP:369496223
complement(3373)-g, cdbSNP:11951036
complement(3427)-c, adbSNP:181245129
complement(3443)-t, cdbSNP:376149433
complement(3698)-g, adbSNP:139731784
complement(3867)-t, gdbSNP:80239077
complement(3902)-g, adbSNP:372574255
complement(3919)-g, adbSNP:10037615
complement(4103)-g, adbSNP:374810214
complement(4130)-t, cdbSNP:141595354
complement(4135)-t, cdbSNP:62364162
complement(4139)-t, cdbSNP:376296879
complement(4161)-g, adbSNP:370864671
complement(4541)-t, cdbSNP:188677511
complement(4584)-g, cdbSNP:184264995
4616+a, cdbSNP:1127781
4658+a, gdbSNP:148788452
complement(4669)-, adbSNP:199990942
4670+c, tdbSNP:3184084
Gene SymbolEDIL3
Gene SynonymDEL1
Chromosome5
Locus Map5q14
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005711 Homo sapiens EGF-like repeats and discoidin I-like domains 3 (EDIL3), transcript variant 1, mRNA. On-demand $699.00 18
NM_001278642 Homo sapiens EGF-like repeats and discoidin I-like domains 3 (EDIL3), transcript variant 2, mRNA. On-demand $699.00 18
Title Genome-wide association study identifies loci affecting blood copper, selenium and zinc .
Author Evans DM, Zhu G, Dy V, Heath AC, Madden PA, Kemp JP, McMahon G, St Pourcain B, Timpson NJ, Golding J, Lawlor DA, Steer C, Montgomery GW, Martin NG, Smith GD and Whitfield JB.
Journal Hum. Mol. Genet. 22 (19), 3998-4006 (2013)
Title Role of the endothelial-derived endogenous anti-inflammatory factor Del-1 in inflammation-mediated adrenal gland dysfunction .
Author Kanczkowski W, Chatzigeorgiou A, Grossklaus S, Sprott D, Bornstein
Journal Endocrinology 154 (3), 1181-1189 (2013)
Title APOE and BCHE as modulators of cerebral amyloid deposition: a florbetapir PET genome-wide association study .
Author Ramanan VK, Risacher SL, Nho K, Kim S, Swaminathan S, Shen L, Foroud TM, Hakonarson H, Huentelman MJ, Aisen PS, Petersen RC, Green RC, Jack CR, Koeppe RA, Jagust WJ, Weiner MW and Saykin AJ.
Journal Mol. Psychiatry (2013) In press
Title The RGD finger of Del-1 is a unique structural feature critical for integrin binding .
Author Schurpf T, Chen Q, Liu JH, Wang R, Springer TA and Wang JH.
Journal FASEB J. 26 (8), 3412-3420 (2012)
Title Developmental endothelial locus-1 (Del-1) mediates clearance of platelet microparticles by the endothelium .
Author Dasgupta SK, Le A, Chavakis T, Rumbaut RE and Thiagarajan P.
Journal Circulation 125 (13), 1664-1672 (2012)
Title The ERAP2 gene is associated with preeclampsia in Australian and Norwegian populations .
Author Johnson MP, Roten LT, Dyer TD, East CE, Forsmo S, Blangero J, Brennecke SP, Austgulen R and Moses EK.
Journal Hum. Genet. 126 (5), 655-666 (2009)
Title Downregulation of developmentally regulated endothelial cell locus-1 inhibits the growth of colon cancer .
Author Zou X, Qiao H, Jiang X, Dong X, Jiang H and Sun X.
Journal J. Biomed. Sci. 16, 33 (2009)
Title The role of adhesion molecules, alpha v beta 3, alpha v beta 5 and their ligands in the tumor cell and endothelial cell adhesion .
Author Niu JX, Zhang WJ, Ye LY, Wu LQ, Zhu GJ, Yang ZH, Grau GE and Lou JN.
Journal Eur. J. Cancer Prev. 16 (6), 517-527 (2007)
Title The embryonic angiogenic factor Del1 accelerates tumor growth by enhancing vascular formation .
Author Aoka Y, Johnson FL, Penta K, Hirata Ki K, Hidai C, Schatzman R, Varner JA and Quertermous T.
Journal Microvasc. Res. 64 (1), 148-161 (2002)
Title Cloning and characterization of developmental endothelial locus-1: an embryonic endothelial cell protein that binds the alphavbeta3 integrin receptor .
Author Hidai C, Zupancic T, Penta K, Mikhail A, Kawana M, Quertermous EE, Aoka Y, Fukagawa M, Matsui Y, Platika D, Auerbach R, Hogan BL, Snodgrass R and Quertermous T.
Journal Genes Dev. 12 (1), 21-33 (1998)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.