• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu03280 Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu03280C Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_005767.5, 241982698
Length 1035 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, mRNA.
Product lysophosphatidic acid receptor 6
Comment

Summary: The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. This gene aligns with an internal intron of the retinoblastoma susceptibility gene in the reverse orientation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2009].


Transcript Variant: This variant (1) represents the longest transcript. Variants 1, 2, and 3 encode the same protein.

RefSeq NP_005758.2
CDS 1626..2660
Misc Feature(1)1560..1562
Misc Feature(2)1683..1763
Misc Feature(3)1683..1763
Misc Feature(4)1710..>2051
Misc Feature(5)1743..2498
Misc Feature(6)1791..1862
Misc Feature(7)1902..1961
Misc Feature(8)2025..2087
Misc Feature(9)2169..2252
Misc Feature(10)2307..2384
Misc Feature(11)2442..2501
Exon (1)1..152
Gene:LPAR6
Gene Synonym:ARWH1; LAH3; P2RY5; P2Y5
Exon (2)153..279
Gene:LPAR6
Gene Synonym:ARWH1; LAH3; P2RY5; P2Y5
Exon (3)280..420
Gene:LPAR6
Gene Synonym:ARWH1; LAH3; P2RY5; P2Y5
Exon (4)421..574
Gene:LPAR6
Gene Synonym:ARWH1; LAH3; P2RY5; P2Y5
Exon (5)575..826
Gene:LPAR6
Gene Synonym:ARWH1; LAH3; P2RY5; P2Y5
Exon (6)827..937
Gene:LPAR6
Gene Synonym:ARWH1; LAH3; P2RY5; P2Y5
Exon (7)938..3004
Gene:LPAR6
Gene Synonym:ARWH1; LAH3; P2RY5; P2Y5
Translation MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLA MSDLLFVFTLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVY PFKSKTLRTKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTY LSRIVIFIEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCF CFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQN SIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESAA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(56)-dbSNP:
complement(56)-g, adbSNP:9595909
complement(59)-g, adbSNP:74243495
complement(76)-g, adbSNP:61948667
complement(102)-g, adbSNP:78740018
complement(151)-g, adbSNP:368284058
complement(226)-dbSNP:
complement(226)-t, cdbSNP:117402689
complement(407)-dbSNP:
complement(407)-t, cdbSNP:115959473
complement(499)-dbSNP:
complement(499)-c, adbSNP:186276465
complement(518)-g, adbSNP:370351056
533+c, tdbSNP:174859
complement(554)-g, adbSNP:367878293
complement(555)-t, cdbSNP:115212976
complement(668)-dbSNP:
complement(668)-t, cdbSNP:114654883
complement(683)-g, adbSNP:146619428
complement(685)-t, cdbSNP:111796313
complement(719)-g, adbSNP:116183893
complement(724)-t, cdbSNP:117361889
complement(724)-t, cdbSNP:386442458
complement(786)-c, adbSNP:144292890
complement(825)-t, cdbSNP:117687990
complement(836)-dbSNP:
complement(836)-g, adbSNP:114194215
complement(841)-g, adbSNP:148682734
complement(1153)-dbSNP:
complement(1153)-t, cdbSNP:386561599
1153+c, tdbSNP:2227311
complement(1245)-t, gdbSNP:372223291
complement(1356)-t, cdbSNP:4151554
complement(1358)-t, gdbSNP:368883146
1434+c, tdbSNP:2233571
complement(1435)-t, cdbSNP:146822744
complement(1518)-t, gdbSNP:10220031
complement(1519)-g, cdbSNP:10220269
1546+c, tdbSNP:2233572
complement(1584)-g, cdbSNP:370734130
complement(1604)-g, cdbSNP:377685150
complement(1615)-g, cdbSNP:373712773
complement(1634)-g, adbSNP:369056064
complement(1635)-t, cdbSNP:200140945
complement(1649)-g, adbSNP:377558597
complement(1656)-g, adbSNP:373090147
complement(1667)-g, adbSNP:148227482
complement(1700)-g, adbSNP:369191907
1722+a, gdbSNP:1060585
complement(1727)-t, gdbSNP:143022858
complement(1730)-g, adbSNP:372877264
complement(1735)-g, adbSNP:187575622
complement(1750)-c, adbSNP:200529724
complement(1756)-t, cdbSNP:201386780
complement(1758)-t, cdbSNP:201988975
complement(1771)-t, cdbSNP:149045565
complement(1774)-t, cdbSNP:199946508
complement(1777)-t, cdbSNP:145842102
complement(1793)-t, cdbSNP:146907520
complement(1823)-g, adbSNP:199707535
complement(1836)-g, adbSNP:369585175
complement(1881)-t, cdbSNP:200247168
complement(1892)-g, adbSNP:202132018
complement(1908)-t, gdbSNP:142504579
complement(1930)-t, cdbSNP:201217722
complement(1957)-g, cdbSNP:201395083
complement(1965)-g, adbSNP:184642826
complement(1967)-t, cdbSNP:371946786
complement(2032)-g, adbSNP:367945288
complement(2036)-g, cdbSNP:4151553
2061+a, gdbSNP:121434308
complement(2067)-t, cdbSNP:113697253
complement(2072)-t, gdbSNP:199857507
complement(2073)-g, adbSNP:374984103
complement(2075..2076)-, gggdbSNP:371252093
2088+c, tdbSNP:121434306
complement(2176)-g, adbSNP:147725894
complement(2178)-c, adbSNP:201663895
2187+a, tdbSNP:121434307
2190+a, gdbSNP:121434309
complement(2196)-g, cdbSNP:200893624
complement(2210)-t, g, cdbSNP:2233573
complement(2212)-g, adbSNP:115596308
complement(2238)-t, cdbSNP:374244267
complement(2260)-g, cdbSNP:61741709
complement(2263)-t, gdbSNP:112592020
2267+a, tdbSNP:1060587
complement(2383)-g, cdbSNP:151284148
complement(2426)-t, gdbSNP:4151552
complement(2440)-g, adbSNP:114372872
complement(2479)-c, adbSNP:148717423
complement(2493)-t, cdbSNP:371355582
complement(2509)-g, cdbSNP:367788266
complement(2510)-c, adbSNP:146017569
complement(2546)-c, adbSNP:17071686
complement(2560)-g, cdbSNP:374589872
complement(2613)-t, gdbSNP:200554714
complement(2633)-t, cdbSNP:151047164
complement(2664)-t, cdbSNP:187023731
complement(2682)-g, adbSNP:199942001
complement(2711)-c, adbSNP:375478050
complement(2746)-t, gdbSNP:4151551
complement(2785..2786)-, adbSNP:34111133
complement(2880)-g, cdbSNP:4151550
complement(2908)-g, cdbSNP:377029953
Gene SymbolLPAR6
Gene SynonymARWH1; LAH3; P2RY5; P2Y5
Chromosome13
Locus Map13q14
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005767 Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, mRNA. In-stock $99.00 5-7
NM_005767 Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, mRNA. In-stock $99.00 5-7
NM_005767 Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, mRNA. In-stock $99.00 5-7
Title Mutations in LPAR6/P2RY5 and LIPH are associated with woolly hair and/or hypotrichosis .
Author Kurban M, Wajid M, Shimomura Y and Christiano AM.
Journal J Eur Acad Dermatol Venereol 27 (5), 545-549 (2013)
Title Comparing the differential effects of LPA on the barrier function of human pulmonary endothelial cells .
Author Ren Y, Guo L, Tang X, Apparsundaram S, Kitson C, Deguzman J, Fuentes ME, Coyle L, Majmudar R, Allard J, Truitt T, Hamid R, Chen Y, Qian Y and Budd DC.
Journal Microvasc. Res. 85, 59-67 (2013)
Title A novel mutation in lysophosphatidic acid receptor 6 gene in autosomal recessive hypotrichosis and evidence for a founder effect .
Author Azhar A, Tariq M, Baig SM, Dahl N and Klar J.
Journal Eur J Dermatol 22 (4), 464-466 (2012)
Title Identification of an Alu-mediated 12.2-kb deletion of the complete LPAR6 (P2RY5) gene in a Turkish family with hypotrichosis and woolly hair .
Author Mahmoudi,H., Tug,E., Parlak,A.H., Atasoy,H.I., Ludwig,M., Polat,M., Pasternack,S.M. and Betz,R.C.
Journal Exp. Dermatol. 21 (6), 469-471 (2012)
Title Mutations in the LPAR6 and LIPH genes underlie autosomal recessive hypotrichosis/woolly hair in 17 consanguineous families from Pakistan .
Author Khan S, Habib R, Mir H, Umm-e-Kalsoom, Naz G, Ayub M, Shafique S, Yamin T, Ali N, Basit S, Wasif N, Kamran-Ul-Hassan Naqvi S, Ali G, Wali A, Ansar M and Ahmad W.
Journal Clin. Exp. Dermatol. 36 (6), 652-654 (2011)
Title Expression of purinergic receptors (ionotropic P2X1-7 and metabotropic P2Y1-11) during myeloid differentiation of HL60 cells .
Author Adrian K, Bernhard MK, Breitinger HG and Ogilvie A.
Journal Biochim. Biophys. Acta 1492 (1), 127-138 (2000)
Title Receptors for purines and pyrimidines .
Author Ralevic V and Burnstock G.
Journal Pharmacol. Rev. 50 (3), 413-492 (1998)
Title The 6H1 orphan receptor, claimed to be the p2y5 receptor, does not mediate nucleotide-promoted second messenger responses .
Author Li Q, Schachter JB, Harden TK and Nicholas RA.
Journal Biochem. Biophys. Res. Commun. 236 (2), 455-460 (1997)
Title Intron 17 of the human retinoblastoma susceptibility gene encodes an actively transcribed G protein-coupled receptor gene .
Author Herzog H, Darby K, Hort YJ and Shine J.
Journal Genome Res. 6 (9), 858-861 (1996)
Title Complete genomic sequence of the human retinoblastoma susceptibility gene .
Author Toguchida J, McGee TL, Paterson JC, Eagle JR, Tucker S, Yandell DW and Dryja TP.
Journal Genomics 17 (3), 535-543 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.