• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_005767 Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, mRNA. ORF Sequence $300.15
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_005767.5, 241982698
Length 3043 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, mRNA.
Product lysophosphatidic acid receptor 6
Comment

Summary: The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. This gene aligns with an internal intron of the retinoblastoma susceptibility gene in the reverse orientation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2009].


Transcript Variant: This variant (1) represents the longest transcript. Variants 1, 2, and 3 encode the same protein.

RefSeq NP_005758.2
CDS 1626..2660
Misc Feature(1)1560..1562
Misc Feature(2)1683..1763
Misc Feature(3)1683..1763
Misc Feature(4)1710..>2051
Misc Feature(5)1743..2498
Misc Feature(6)1791..1862
Misc Feature(7)1902..1961
Misc Feature(8)2025..2087
Misc Feature(9)2169..2252
Misc Feature(10)2307..2384
Misc Feature(11)2442..2501
Exon (1)1..152
Gene:LPAR6
Gene Synonym:ARWH1; LAH3; P2RY5; P2Y5
Exon (2)153..279
Gene:LPAR6
Gene Synonym:ARWH1; LAH3; P2RY5; P2Y5
Exon (3)280..420
Gene:LPAR6
Gene Synonym:ARWH1; LAH3; P2RY5; P2Y5
Exon (4)421..574
Gene:LPAR6
Gene Synonym:ARWH1; LAH3; P2RY5; P2Y5
Exon (5)575..826
Gene:LPAR6
Gene Synonym:ARWH1; LAH3; P2RY5; P2Y5
Exon (6)827..937
Gene:LPAR6
Gene Synonym:ARWH1; LAH3; P2RY5; P2Y5
Exon (7)938..3004
Gene:LPAR6
Gene Synonym:ARWH1; LAH3; P2RY5; P2Y5
Translation MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLA MSDLLFVFTLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVY PFKSKTLRTKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTY LSRIVIFIEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCF CFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQN SIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESAA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(56)-dbSNP:
complement(56)-g, adbSNP:9595909
complement(59)-g, adbSNP:74243495
complement(76)-g, adbSNP:61948667
complement(102)-g, adbSNP:78740018
complement(226)-dbSNP:
complement(226)-t, cdbSNP:117402689
complement(407)-dbSNP:
complement(407)-t, cdbSNP:115959473
complement(499)-dbSNP:
complement(499)-c, adbSNP:186276465
complement(533)-t, cdbSNP:174859
complement(555)-t, cdbSNP:115212976
complement(668)-dbSNP:
complement(668)-t, cdbSNP:114654883
complement(683)-g, adbSNP:146619428
complement(685)-t, cdbSNP:111796313
complement(719)-g, adbSNP:116183893
complement(724)-t, cdbSNP:117361889
complement(786)-c, adbSNP:144292890
complement(825)-t, cdbSNP:117687990
complement(836)-dbSNP:
complement(836)-g, adbSNP:114194215
complement(841)-g, adbSNP:148682734
complement(1153)-dbSNP:
complement(1153)-t, cdbSNP:2227311
complement(1356)-t, cdbSNP:4151554
complement(1434)-t, cdbSNP:2233571
complement(1435)-t, cdbSNP:146822744
complement(1518)-t, gdbSNP:10220031
complement(1519)-g, cdbSNP:10220269
complement(1546)-t, cdbSNP:2233572
complement(1635)-t, cdbSNP:200140945
complement(1667)-g, adbSNP:148227482
complement(1722)-g, adbSNP:1060585
complement(1727)-t, gdbSNP:143022858
complement(1735)-g, adbSNP:187575622
complement(1750)-c, adbSNP:200529724
complement(1756)-t, cdbSNP:201386780
complement(1758)-t, cdbSNP:201988975
complement(1771)-t, cdbSNP:149045565
complement(1774)-t, cdbSNP:199946508
complement(1777)-t, cdbSNP:145842102
complement(1793)-t, cdbSNP:146907520
complement(1823)-g, adbSNP:199707535
complement(1881)-t, cdbSNP:200247168
complement(1892)-g, adbSNP:202132018
complement(1908)-t, gdbSNP:142504579
complement(1930)-t, cdbSNP:201217722
complement(1957)-g, cdbSNP:201395083
complement(1965)-g, adbSNP:184642826
complement(2036)-g, cdbSNP:4151553
complement(2061)-g, adbSNP:121434308
complement(2067)-t, cdbSNP:113697253
complement(2072)-t, gdbSNP:199857507
complement(2088)-t, cdbSNP:121434306
complement(2176)-g, adbSNP:147725894
complement(2178)-c, adbSNP:201663895
complement(2187)-t, adbSNP:121434307
complement(2190)-g, adbSNP:121434309
complement(2196)-g, cdbSNP:200893624
complement(2210)-t, g, cdbSNP:2233573
complement(2212)-g, adbSNP:115596308
complement(2252..2253)-, tdbSNP:67908709
complement(2260)-g, cdbSNP:61741709
complement(2263)-t, gdbSNP:112592020
complement(2267)-t, adbSNP:1060587
complement(2383)-g, cdbSNP:151284148
complement(2426)-t, gdbSNP:4151552
complement(2440)-g, adbSNP:114372872
complement(2479)-c, adbSNP:148717423
complement(2510)-c, adbSNP:146017569
complement(2546)-c, adbSNP:17071686
complement(2613)-t, gdbSNP:200554714
complement(2633)-t, cdbSNP:151047164
complement(2664)-t, cdbSNP:187023731
complement(2682)-g, adbSNP:199942001
complement(2746)-t, gdbSNP:4151551
complement(2785..2786)-, adbSNP:34111133
complement(2880)-g, cdbSNP:4151550
Gene SymbolLPAR6
Gene SynonymARWH1; LAH3; P2RY5; P2Y5
Chromosome13
Locus Map13q14
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001162497 Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 2, mRNA. Full Length $742.69
ORF Sequence $300.15
NM_001162498 Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 3, mRNA. Full Length $728.48
ORF Sequence $300.15
NM_005767 Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, mRNA. Full Length $1065.05
ORF Sequence $300.15
Title A novel mutation in lysophosphatidic acid receptor 6 gene in autosomal recessive hypotrichosis and evidence for a founder effect .
Author Azhar,A., Tariq,M., Baig,S.M., Dahl,N. and Klar,J.
Journal Eur J Dermatol 22 (4), 464-466 (2012)
Title Identification of an Alu-mediated 12.2-kb deletion of the complete LPAR6 (P2RY5) gene in a Turkish family with hypotrichosis and woolly hair .
Author Mahmoudi,H., Tug,E., Parlak,A.H., Atasoy,H.I., Ludwig,M., Polat,M., Pasternack,S.M. and Betz,R.C.
Journal Exp. Dermatol. 21 (6), 469-471 (2012)
Title Mutations in the LPAR6 and LIPH genes underlie autosomal recessive hypotrichosis/woolly hair in 17 consanguineous families from Pakistan .
Author Khan,S., Habib,R., Mir,H., Umm-e-Kalsoom, Naz,G., Ayub,M., Shafique,S., Yamin,T., Ali,N., Basit,S., Wasif,N., Kamran-Ul-Hassan Naqvi,S., Ali,G., Wali,A., Ansar,M. and Ahmad,W.
Journal Clin. Exp. Dermatol. 36 (6), 652-654 (2011)
Title Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph .
Author Casabonne,D., Reina,O., Benavente,Y., Becker,N., Maynadie,M., Foretova,L., Cocco,P., Gonzalez-Neira,A., Nieters,A., Boffetta,P., Middeldorp,J.M. and de Sanjose,S.
Journal Haematologica 96 (2), 323-327 (2011)
Title Novel mutations in the P2RY5 gene in one Turkish and two Indian patients presenting with hypotrichosis and woolly hair .
Author Pasternack,S.M., Murugusundram,S., Eigelshoven,S., Muller,M., Kruse,R., Lehmann,P. and Betz,R.C.
Journal Arch. Dermatol. Res. 301 (8), 621-624 (2009)
Title Expression of purinergic receptors (ionotropic P2X1-7 and metabotropic P2Y1-11) during myeloid differentiation of HL60 cells .
Author Adrian,K., Bernhard,M.K., Breitinger,H.G. and Ogilvie,A.
Journal Biochim. Biophys. Acta 1492 (1), 127-138 (2000)
Title Receptors for purines and pyrimidines .
Author Ralevic,V. and Burnstock,G.
Journal Pharmacol. Rev. 50 (3), 413-492 (1998)
Title The 6H1 orphan receptor, claimed to be the p2y5 receptor, does not mediate nucleotide-promoted second messenger responses .
Author Li,Q., Schachter,J.B., Harden,T.K. and Nicholas,R.A.
Journal Biochem. Biophys. Res. Commun. 236 (2), 455-460 (1997)
Title Intron 17 of the human retinoblastoma susceptibility gene encodes an actively transcribed G protein-coupled receptor gene .
Author Herzog,H., Darby,K., Hort,Y.J. and Shine,J.
Journal Genome Res. 6 (9), 858-861 (1996)
Title Complete genomic sequence of the human retinoblastoma susceptibility gene .
Author Toguchida,J., McGee,T.L., Paterson,J.C., Eagle,J.R., Tucker,S., Yandell,D.W. and Dryja,T.P.
Journal Genomics 17 (3), 535-543 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878