• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens isocitrate dehydrogenase 1 (NADP+), soluble (IDH1), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu21156 Homo sapiens isocitrate dehydrogenase 1 (NADP+), soluble (IDH1), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu21156C Homo sapiens isocitrate dehydrogenase 1 (NADP+), soluble (IDH1), transcript variant 1, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_005896.3, 538917457
Length 1245 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens isocitrate dehydrogenase 1 (NADP+), soluble (IDH1), transcript variant 1, mRNA.
Product isocitrate dehydrogenase [NADP] cytoplasmic
Comment

Summary: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2013].


Transcript Variant: This variant (1) and variants 2 and 3 encode the same protein.

RefSeq NP_005887.2
CDS 296..1540
Misc Feature(1)257..259
Misc Feature(2)296..1528
Misc Feature(3)296..1528
Misc Feature(4)299..301
Misc Feature(5)575..595
Misc Feature(6)710..712
Misc Feature(7)929..931
Misc Feature(8)1256..1258
Exon (1)1..205
Gene:IDH1
Gene Synonym:HEL-216; HEL-S-26; IDCD; IDH; IDP; IDPC; PICD
Exon (2)206..279
Gene:IDH1
Gene Synonym:HEL-216; HEL-S-26; IDCD; IDH; IDP; IDPC; PICD
Exon (3)280..417
Gene:IDH1
Gene Synonym:HEL-216; HEL-S-26; IDCD; IDH; IDP; IDPC; PICD
Exon (4)418..709
Gene:IDH1
Gene Synonym:HEL-216; HEL-S-26; IDCD; IDH; IDP; IDPC; PICD
Exon (5)710..815
Gene:IDH1
Gene Synonym:HEL-216; HEL-S-26; IDCD; IDH; IDP; IDPC; PICD
Exon (6)816..993
Gene:IDH1
Gene Synonym:HEL-216; HEL-S-26; IDCD; IDH; IDP; IDPC; PICD
Exon (7)994..1145
Gene:IDH1
Gene Synonym:HEL-216; HEL-S-26; IDCD; IDH; IDP; IDPC; PICD
Exon (8)1146..1286
Gene:IDH1
Gene Synonym:HEL-216; HEL-S-26; IDCD; IDH; IDP; IDPC; PICD
Exon (9)1287..1449
Gene:IDH1
Gene Synonym:HEL-216; HEL-S-26; IDCD; IDH; IDP; IDPC; PICD
Exon (10)1450..2392
Gene:IDH1
Gene Synonym:HEL-216; HEL-S-26; IDCD; IDH; IDP; IDPC; PICD
Translation MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL VSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(2)-dbSNP:
complement(2)-t, cdbSNP:183309933
31+a, gdbSNP:28384385
complement(168)-t, gdbSNP:199570676
189+a, gdbSNP:11554139
complement(214)-dbSNP:
complement(214)-t, gdbSNP:144856461
complement(242)-c, adbSNP:77588323
252+g, tdbSNP:11554136
complement(311)-t, cdbSNP:141118556
complement(317)-t, cdbSNP:369048275
complement(341)-g, cdbSNP:192514135
350+a, cdbSNP:11554138
complement(354)-t, cdbSNP:201258988
complement(389)-c, adbSNP:142923780
complement(407)-t, cdbSNP:374907791
complement(454)-dbSNP:
complement(454)-g, adbSNP:200305649
complement(479)-t, cdbSNP:144593536
complement(492)-t, cdbSNP:111834611
complement(506)-t, cdbSNP:73070954
complement(508)-g, cdbSNP:372625136
complement(534)-t, adbSNP:201790850
complement(538)-t, cdbSNP:368642313
complement(589)-g, adbSNP:147684527
complement(592)-t, cdbSNP:142883642
610+c, tdbSNP:11554137
complement(614)-t, cdbSNP:375658806
complement(619)-t, gdbSNP:199905024
complement(629)-t, cdbSNP:148542200
complement(647)-g, adbSNP:371567806
complement(661)-g, adbSNP:142572024
689+a, c, tdbSNP:121913499
690+a, gdbSNP:121913500
complement(730)-dbSNP:
complement(730)-g, adbSNP:200875728
complement(751)-t, cdbSNP:145324788
complement(775)-g, adbSNP:368904931
complement(776)-t, cdbSNP:148190775
complement(825)-dbSNP:
complement(825)-t, cdbSNP:149205273
complement(827)-t, cdbSNP:34218846
complement(833)-t, cdbSNP:374474539
complement(843)-t, cdbSNP:34599179
complement(860)-t, cdbSNP:62193615
complement(888)-t, cdbSNP:374340555
complement(893)-c, adbSNP:370342586
complement(918)-t, cdbSNP:186787509
complement(922)-g, cdbSNP:182693596
complement(943)-t, cdbSNP:377538429
complement(954)-t, cdbSNP:142801125
complement(1003)-dbSNP:
complement(1003)-t, cdbSNP:150747919
complement(1021)-t, cdbSNP:377075054
complement(1031)-g, adbSNP:373048968
complement(1048)-g, adbSNP:139287550
complement(1052)-t, cdbSNP:201394139
complement(1091)-t, cdbSNP:199793362
complement(1113)-t, cdbSNP:369039979
complement(1120)-g, adbSNP:374900600
complement(1127)-g, adbSNP:201822210
complement(1129)-t, cdbSNP:369424896
complement(1131)-t, cdbSNP:200372440
complement(1167)-dbSNP:
complement(1167)-g, adbSNP:141630472
complement(1170)-t, gdbSNP:62193614
complement(1178)-g, adbSNP:370928521
complement(1188)-g, adbSNP:201477228
complement(1189)-t, cdbSNP:188499120
complement(1212)-t, gdbSNP:138458978
complement(1234)-g, adbSNP:267599174
complement(1248)-g, adbSNP:377475055
complement(1253)-g, adbSNP:202210066
complement(1254)-t, cdbSNP:199915613
complement(1259)-t, cdbSNP:113732076
complement(1270)-t, cdbSNP:148160119
complement(1271)-g, adbSNP:185564694
complement(1339)-dbSNP:
complement(1339)-g, cdbSNP:200718328
complement(1385)-t, cdbSNP:372711897
complement(1395)-g, adbSNP:200591678
complement(1414)-g, adbSNP:369234651
complement(1415)-t, cdbSNP:201267625
complement(1444)-t, gdbSNP:141895800
1540+a, cdbSNP:3778
complement(1554)-g, adbSNP:114939378
complement(1590)-g, cdbSNP:200122564
complement(1647)-c, adbSNP:185188955
complement(1656)-t, cdbSNP:112722672
complement(1694)-g, adbSNP:78539882
complement(1835)-g, adbSNP:369898908
1876+a, gdbSNP:1044416
2031..2032+a, tdbSNP:13026
complement(2032)-c, adbSNP:6730955
complement(2122)-t, cdbSNP:150906753
complement(2141)-t, cdbSNP:180928167
complement(2180)-g, cdbSNP:16841606
2247+c, tdbSNP:15344
complement(2278)-t, gdbSNP:369225330
Gene SymbolIDH1
Gene SynonymHEL-216; HEL-S-26; IDCD; IDH; IDP; IDPC; PICD
Chromosome2
Locus Map2q33.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005896 Homo sapiens isocitrate dehydrogenase 1 (NADP+), soluble (IDH1), transcript variant 1, mRNA. On-demand $219.00 7-9
NM_005896 Homo sapiens isocitrate dehydrogenase 1 (NADP+), soluble (IDH1), transcript variant 1, mRNA. On-demand $219.00 7-9
NM_005896 Homo sapiens isocitrate dehydrogenase 1 (NADP+), soluble (IDH1), transcript variant 1, mRNA. On-demand $219.00 7-9
Title Up-regulated isocitrate dehydrogenase 1 suppresses proliferation, migration and invasion in osteosarcoma: in vitro and in vivo .
Author Hu X, Liu Y, Qin C, Pan Z, Luo J, Yu A and Cheng Z.
Journal Cancer Lett. 346 (1), 114-121 (2014)
Title Correlation of IDH1/2 mutation with clinicopathologic factors and prognosis in anaplastic gliomas: a report of 203 patients from China .
Author Zhang CB, Bao ZS, Wang HJ, Yan W, Liu YW, Li MY, Zhang W, Chen L and Jiang T.
Journal J. Cancer Res. Clin. Oncol. 140 (1), 45-51 (2014)
Title Prognostic or predictive value of MGMT promoter methylation in gliomas depends on IDH1 mutation .
Author Wick W, Meisner C, Hentschel B, Platten M, Schilling A, Wiestler B, Sabel MC, Koeppen S, Ketter R, Weiler M, Tabatabai G, von Deimling A, Gramatzki D, Westphal M, Schackert G, Loeffler M, Simon M, Reifenberger G and Weller M.
Journal Neurology 81 (17), 1515-1522 (2013)
Title [Mutation of isocitrate dehydrogenase gene in Chinese patients with glioma] .
Author Pan Y, Qi XL, Wang LM, Dong RF, Zhang M, Zheng DF, Chang Q and Zhong YF.
Journal Zhonghua Bing Li Xue Za Zhi 42 (5), 292-298 (2013)
Title Non-invasive in vivo assessment of IDH1 mutational status in glioma .
Author Chaumeil MM, Larson PE, Yoshihara HA, Danforth OM, Vigneron DB, Nelson SJ, Pieper RO, Phillips JJ and Ronen SM.
Journal Nat Commun 4, 2429 (2013)
Title Cytosolic isocitrate dehydrogenase in humans, mice, and voles and phylogenetic analysis of the enzyme family .
Author Nekrutenko A, Hillis DM, Patton JC, Bradley RD and Baker RJ.
Journal Mol. Biol. Evol. 15 (12), 1674-1684 (1998)
Title Fatty acid synthesis from glutamate in the adipose tissue of normal subjects and obese patients: an enzyme study .
Author Belfiore F and Iannello S.
Journal Biochem. Mol. Med. 54 (1), 19-25 (1995)
Title Probable assignment of soluble isocitrate dehydrogenase (IDH1) to 2q33.3 .
Author Narahara,K., Kimura,S., Kikkawa,K., Takahashi,Y., Wakita,Y., Kasai,R., Nagai,S., Nishibayashi,Y. and Kimoto,H.
Journal Hum. Genet. 71 (1), 37-40 (1985)
Title Chromosome assignments of genes in man using mouse-human somatic cell hybrids: Cytoplasmic isocitrate dehydrogenase (IDH 1) and malate dehydrogenase (MDH 1) to chromosomes 2 .
Author Creagan,R.P., Carritt,B., Chen,S., Kucherlapati,R., McMorris,F.A., Ricciuti,F., Tan,Y.H., Tischfield,J.A. and Ruddle,F.H.
Journal Am. J. Hum. Genet. 26 (5), 604-613 (1974)
Title Intracellular location and genetic control of isozymes of NADP-dependent isocitrate dehydrogenase and malate dehydrogenase .
Author Henderson,N.S.
Journal Ann. N. Y. Acad. Sci. 151 (1), 429-440 (1968)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.