• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens isocitrate dehydrogenase 1 (NADP+), soluble (IDH1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005896 Homo sapiens isocitrate dehydrogenase 1 (NADP+), soluble (IDH1), mRNA. GenEZ ORF Cloning On-demand $549.00 14

*Business Day

Related Services

RefSeq Version NM_005896.2, 28178824
Length 2339 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens isocitrate dehydrogenase 1 (NADP+), soluble (IDH1), mRNA.
Product isocitrate dehydrogenase [NADP] cytoplasmic
Comment

Summary: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. [provided by RefSeq, Jul 2008].

RefSeq NP_005887.2
CDS 235..1479
Misc Feature(1)196..198
Misc Feature(2)235..1467
Misc Feature(3)235..1467
Misc Feature(4)514..534
Misc Feature(5)649..651
Misc Feature(6)868..870
Misc Feature(7)1195..1197
Misc Feature(8)1468..1476
Exon (1)1..144
Gene:IDH1
Gene Synonym:IDCD; IDH; IDP; IDPC; PICD
Exon (2)145..218
Gene:IDH1
Gene Synonym:IDCD; IDH; IDP; IDPC; PICD
Exon (3)219..356
Gene:IDH1
Gene Synonym:IDCD; IDH; IDP; IDPC; PICD
Exon (4)357..648
Gene:IDH1
Gene Synonym:IDCD; IDH; IDP; IDPC; PICD
Exon (5)649..754
Gene:IDH1
Gene Synonym:IDCD; IDH; IDP; IDPC; PICD
Exon (6)755..932
Gene:IDH1
Gene Synonym:IDCD; IDH; IDP; IDPC; PICD
Exon (7)933..1084
Gene:IDH1
Gene Synonym:IDCD; IDH; IDP; IDPC; PICD
Exon (8)1085..1225
Gene:IDH1
Gene Synonym:IDCD; IDH; IDP; IDPC; PICD
Exon (9)1226..1388
Gene:IDH1
Gene Synonym:IDCD; IDH; IDP; IDPC; PICD
Exon (10)1389..2329
Gene:IDH1
Gene Synonym:IDCD; IDH; IDP; IDPC; PICD
Translation MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL VSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(107)-dbSNP:
complement(107)-t, gdbSNP:199570676
complement(128)-g, adbSNP:11554139
complement(153)-dbSNP:
complement(153)-t, gdbSNP:144856461
complement(181)-c, adbSNP:77588323
complement(191)-t, gdbSNP:11554136
complement(250)-t, cdbSNP:141118556
complement(280)-g, cdbSNP:192514135
complement(289)-c, adbSNP:11554138
complement(293)-t, cdbSNP:201258988
complement(328)-c, adbSNP:142923780
complement(393)-dbSNP:
complement(393)-g, adbSNP:200305649
complement(418)-t, cdbSNP:144593536
complement(431)-t, cdbSNP:111834611
complement(445)-t, cdbSNP:73070954
complement(473)-t, adbSNP:201790850
complement(528)-g, adbSNP:147684527
complement(531)-t, cdbSNP:142883642
complement(549)-t, cdbSNP:11554137
complement(558)-t, gdbSNP:199905024
complement(568)-t, cdbSNP:148542200
complement(600)-g, adbSNP:142572024
complement(628)-t, c, adbSNP:121913499
complement(629)-g, adbSNP:121913500
complement(669)-dbSNP:
complement(669)-g, adbSNP:200875728
complement(690)-t, cdbSNP:145324788
complement(715)-t, cdbSNP:148190775
complement(764)-dbSNP:
complement(764)-t, cdbSNP:149205273
complement(766)-t, cdbSNP:34218846
complement(782)-t, cdbSNP:34599179
complement(799)-t, cdbSNP:62193615
complement(857)-t, cdbSNP:186787509
complement(861)-g, cdbSNP:182693596
complement(893)-t, cdbSNP:142801125
complement(942)-dbSNP:
complement(942)-t, cdbSNP:150747919
complement(987)-g, adbSNP:139287550
complement(991)-t, cdbSNP:201394139
complement(1030)-t, cdbSNP:199793362
complement(1066)-g, adbSNP:201822210
complement(1070)-t, cdbSNP:200372440
complement(1106)-dbSNP:
complement(1106)-g, adbSNP:141630472
complement(1109)-t, gdbSNP:62193614
complement(1127)-g, adbSNP:201477228
complement(1128)-t, cdbSNP:188499120
complement(1151)-t, gdbSNP:138458978
complement(1192)-g, adbSNP:202210066
complement(1193)-t, cdbSNP:199915613
complement(1198)-t, cdbSNP:113732076
complement(1209)-t, cdbSNP:148160119
complement(1210)-g, adbSNP:185564694
complement(1278)-dbSNP:
complement(1278)-g, cdbSNP:200718328
complement(1334)-g, adbSNP:200591678
complement(1354)-t, cdbSNP:201267625
complement(1383)-t, gdbSNP:141895800
complement(1479)-c, adbSNP:3778
complement(1493)-g, adbSNP:114939378
complement(1529)-g, cdbSNP:200122564
complement(1586)-c, adbSNP:185188955
complement(1595)-t, cdbSNP:112722672
complement(1633)-g, adbSNP:78539882
complement(1815)-g, adbSNP:1044416
complement(1970)-t, adbSNP:13026
complement(1971)-c, adbSNP:6730955
complement(2061)-t, cdbSNP:150906753
complement(2080)-t, cdbSNP:180928167
complement(2119)-g, cdbSNP:16841606
complement(2186)-t, cdbSNP:15344
Gene SymbolIDH1
Gene SynonymIDCD; IDH; IDP; IDPC; PICD
Chromosome2
Locus Map2q33.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005896 Homo sapiens isocitrate dehydrogenase 1 (NADP+), soluble (IDH1), mRNA. On-demand $549.00 14
Title Prognostic impact of the isocitrate dehydrogenase 1 single-nucleotide polymorphism rs11554137 in malignant gliomas .
Author Wang,X.W., Boisselier,B., Rossetto,M., Marie,Y., Idbaih,A., Mokhtari,K., Gousias,K., Hoang-Xuan,K., Delattre,J.Y., Simon,M., Labussiere,M. and Sanson,M.
Journal Cancer 119 (4), 806-813 (2013)
Title Disruption of wild-type IDH1 suppresses D-2-hydroxyglutarate production in IDH1-mutated gliomas .
Author Jin,G., Reitman,Z.J., Duncan,C.G., Spasojevic,I., Gooden,D.M., Rasheed,B.A., Yang,R., Lopez,G.Y., He,Y., McLendon,R.E., Bigner,D.D. and Yan,H.
Journal Cancer Res. 73 (2), 496-501 (2013)
Title Pyrosequencing of IDH1 and IDH2 mutations in brain tumors and non-neoplastic conditions .
Author Cykowski,M.D., Allen,R.A., Fung,K.M., Harmon,M.A. and Dunn,S.T.
Journal Diagn. Mol. Pathol. 21 (4), 214-220 (2012)
Title Prospective serial evaluation of 2-hydroxyglutarate, during treatment of newly diagnosed acute myeloid leukemia, to assess disease activity and therapeutic response .
Author Fathi,A.T., Sadrzadeh,H., Borger,D.R., Ballen,K.K., Amrein,P.C., Attar,E.C., Foster,J., Burke,M., Lopez,H.U., Matulis,C.R., Edmonds,K.M., Iafrate,A.J., Straley,K.S., Yen,K.E., Agresta,S., Schenkein,D.P., Hill,C., Emadi,A., Neuberg,D.S., Stone,R.M. and Chen,Y.B.
Journal Blood 120 (23), 4649-4652 (2012)
Title Hotspot mutations in H3F3A and IDH1 define distinct epigenetic and biological subgroups of glioblastoma .
Author Sturm,D., Witt,H., Hovestadt,V., Khuong-Quang,D.A., Jones,D.T., Konermann,C., Pfaff,E., Tonjes,M., Sill,M., Bender,S., Kool,M., Zapatka,M., Becker,N., Zucknick,M., Hielscher,T., Liu,X.Y., Fontebasso,A.M., Ryzhova,M., Albrecht,S., Jacob,K., Wolter,M., Ebinger,M., Schuhmann,M.U., van Meter,T., Fruhwald,M.C., Hauch,H., Pekrun,A., Radlwimmer,B., Niehues,T., von Komorowski,G., Durken,M., Kulozik,A.E., Madden,J., Donson,A., Foreman,N.K., Drissi,R., Fouladi,M., Scheurlen,W., von Deimling,A., Monoranu,C., Roggendorf,W., Herold-Mende,C., Unterberg,A., Kramm,C.M., Felsberg,J., Hartmann,C., Wiestler,B., Wick,W., Milde,T., Witt,O., Lindroth,A.M., Schwartzentruber,J., Faury,D., Fleming,A., Zakrzewska,M., Liberski,P.P., Zakrzewski,K., Hauser,P., Garami,M., Klekner,A., Bognar,L., Morrissy,S., Cavalli,F., Taylor,M.D., van Sluis,P., Koster,J., Versteeg,R., Volckmann,R., Mikkelsen,T., Aldape,K., Reifenberger,G., Collins,V.P., Majewski,J., Korshunov,A., Lichter,P., Plass,C., Jabado,N. and Pfister,S.M.
Journal Cancer Cell 22 (4), 425-437 (2012)
Title Cytosolic isocitrate dehydrogenase in humans, mice, and voles and phylogenetic analysis of the enzyme family .
Author Nekrutenko,A., Hillis,D.M., Patton,J.C., Bradley,R.D. and Baker,R.J.
Journal Mol. Biol. Evol. 15 (12), 1674-1684 (1998)
Title Fatty acid synthesis from glutamate in the adipose tissue of normal subjects and obese patients: an enzyme study .
Author Belfiore,F. and Iannello,S.
Journal Biochem. Mol. Med. 54 (1), 19-25 (1995)
Title Probable assignment of soluble isocitrate dehydrogenase (IDH1) to 2q33.3 .
Author Narahara,K., Kimura,S., Kikkawa,K., Takahashi,Y., Wakita,Y., Kasai,R., Nagai,S., Nishibayashi,Y. and Kimoto,H.
Journal Hum. Genet. 71 (1), 37-40 (1985)
Title Chromosome assignments of genes in man using mouse-human somatic cell hybrids: Cytoplasmic isocitrate dehydrogenase (IDH 1) and malate dehydrogenase (MDH 1) to chromosomes 2 .
Author Creagan,R.P., Carritt,B., Chen,S., Kucherlapati,R., McMorris,F.A., Ricciuti,F., Tan,Y.H., Tischfield,J.A. and Ruddle,F.H.
Journal Am. J. Hum. Genet. 26 (5), 604-613 (1974)
Title Intracellular location and genetic control of isozymes of NADP-dependent isocitrate dehydrogenase and malate dehydrogenase .
Author Henderson,N.S.
Journal Ann. N. Y. Acad. Sci. 151 (1), 429-440 (1968)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.