• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens SIX homeobox 1 (SIX1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005982 Homo sapiens SIX homeobox 1 (SIX1), mRNA. GenEZ ORF Cloning On-demand $449.00 14

*Business Day

Related Services

RefSeq Version NM_005982.3, 186928837
Length 2687 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens SIX homeobox 1 (SIX1), mRNA.
Product homeobox protein SIX1
Comment

Summary: The protein encoded by this gene is a homeobox protein that is similar to the Drosophila 'sine oculis' gene product. This gene is found in a cluster of related genes on chromosome 14 and is thought to be involved in limb development. Defects in this gene are a cause of autosomal dominant deafness type 23 (DFNA23) and branchiootic syndrome type 3 (BOS3). [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.

RefSeq NP_005973.1
CDS 249..1103
Misc Feature(1)147..149
Misc Feature(2)633..788
Misc Feature(3)633..788
Misc Feature(4)order(633..635,639..641,690..692,708..710,747..749,
Misc Feature(5)order(636..638,756..758,765..770,777..779)
Exon (1)1..808
Gene:SIX1
Gene Synonym:BOS3; DFNA23; TIP39
Exon (2)809..2687
Gene:SIX1
Gene Synonym:BOS3; DFNA23; TIP39
Translation MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHR GNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRT IWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDR AAEAKERENTENNNSSSNKQNQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLLQGNMGH ARSSNYSLPGLTASQPSHGLQTHQHQLQDSLLGPLTSSLVDLGS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(65)-dbSNP:
complement(65)-t, gdbSNP:187402923
complement(112)-g, adbSNP:139621918
complement(128)-g, cdbSNP:375002099
complement(225)-g, adbSNP:201700039
complement(235)-c, adbSNP:374228886
298+a, tdbSNP:397515562
complement(332)-g, cdbSNP:146357380
complement(380)-g, cdbSNP:149166341
complement(410)-t, cdbSNP:150550985
complement(456)-g, adbSNP:372978267
complement(491)-g, adbSNP:369025163
complement(532)-g, adbSNP:200835641
complement(543)-g, adbSNP:17850414
565+g, tdbSNP:397515560
576+c, tdbSNP:80356459
complement(578)-t, cdbSNP:73309461
582+c, tdbSNP:397515561
complement(605)-g, adbSNP:375984653
612+a, tdbSNP:121909770
634+a, gdbSNP:104894478
complement(635)-g, cdbSNP:371614639
645..647+, gagdbSNP:80356460
complement(650)-t, cdbSNP:151189392
complement(719)-g, cdbSNP:368157931
complement(722)-g, c, adbSNP:199743522
complement(740..741)-, gdbSNP:34585587
complement(742)-g, adbSNP:143516729
complement(750)-t, cdbSNP:371998997
complement(771)-t, gdbSNP:139966458
complement(797)-t, cdbSNP:145953540
complement(826)-dbSNP:
complement(826)-t, adbSNP:142301715
complement(848)-t, cdbSNP:61515165
complement(863)-c, adbSNP:148433316
complement(880)-g, adbSNP:374638294
complement(897)-t, cdbSNP:146129487
complement(927)-c, adbSNP:144481204
complement(929)-t, gdbSNP:149265761
complement(980)-t, gdbSNP:202018835
complement(994)-t, gdbSNP:368974927
complement(1002)-t, cdbSNP:200205240
complement(1027)-t, adbSNP:370259896
complement(1059)-g, adbSNP:199522850
complement(1070)-g, adbSNP:368353344
complement(1083)-g, adbSNP:12101095
complement(1125)-t, cdbSNP:374399275
complement(1165)-t, cdbSNP:373673863
complement(1247)-t, cdbSNP:113680815
complement(1309)-c, adbSNP:367844913
complement(1349)-t, cdbSNP:61991660
complement(1352..1353)-t, cdbSNP:35069179
complement(1352)-, tdbSNP:60585662
complement(1368)-, tdbSNP:112733948
complement(1368)-t, gdbSNP:80194537
complement(1381)-t, cdbSNP:185694350
complement(1400)-c, adbSNP:147081368
complement(1437)-g, cdbSNP:10144415
complement(1468)-t, adbSNP:182923762
complement(1506)-g, adbSNP:191393983
complement(1507)-t, cdbSNP:76116881
complement(1546)-t, cdbSNP:186530769
complement(1592)-t, cdbSNP:57517528
complement(1705)-g, cdbSNP:78909843
complement(1762)-g, adbSNP:180814298
complement(1858)-, adbSNP:398025306
complement(1869)-t, adbSNP:63554860
complement(1869)-, adbSNP:33943216
complement(1870..1871)-, adbSNP:199935032
complement(1872)-, tdbSNP:201192478
complement(1942)-g, cdbSNP:189312189
complement(1985)-g, adbSNP:370867168
complement(2111)-, tdbSNP:148821608
complement(2147)-t, gdbSNP:3742637
complement(2195)-t, gdbSNP:186149844
complement(2223)-t, cdbSNP:386585258
complement(2223)-g, adbSNP:3742638
complement(2318)-g, adbSNP:181833190
2373..2374+, atdbSNP:3832952
complement(2479)-g, adbSNP:137994957
complement(2581)-g, cdbSNP:146967331
complement(2599)-g, adbSNP:61993831
complement(2626)-g, adbSNP:140088005
Gene SymbolSIX1
Gene SynonymBOS3; DFNA23; TIP39
Chromosome14
Locus Map14q23.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005982 Homo sapiens SIX homeobox 1 (SIX1), mRNA. On-demand $449.00 14
Title Sine oculis homeobox homolog 1 promotes alpha5beta1-mediated invasive migration and metastasis of cervical cancer cells .
Author Liu D, Zhang XX, Wan DY, Xi BX, Ma D, Wang H and Gao QL.
Journal Biochem. Biophys. Res. Commun. 446 (2), 549-554 (2014)
Title Sineoculis homeobox homolog 1 protein overexpression as an independent biomarker for pancreatic ductal adenocarcinoma .
Author Jin A, Xu Y, Liu S, Jin T, Li Z, Jin H, Lin L and Lin Z.
Journal Exp. Mol. Pathol. 96 (1), 54-60 (2014)
Title Six1 mediates resistance to paclitaxel in breast cancer cells .
Author Li Z, Tian T, Hu X, Zhang X, Nan F, Chang Y, Lv F and Zhang M.
Journal Biochem. Biophys. Res. Commun. 441 (3), 538-543 (2013)
Title Six1 promotes proliferation of pancreatic cancer cells via upregulation of cyclin D1 expression .
Author Li Z, Tian T, Lv F, Chang Y, Wang X, Zhang L, Li X, Li L, Ma W, Wu
Journal PLoS ONE 8 (3), E59203 (2013)
Title A novel locus (DFNA23) for prelingual autosomal dominant nonsyndromic hearing loss maps to 14q21-q22 in a Swiss German kindred .
Author Salam AA, Hafner FM, Linder TE, Spillmann T, Schinzel AA and Leal SM.
Journal Am. J. Hum. Genet. 66 (6), 1984-1988 (2000)
Title Abrogation of the G2 cell cycle checkpoint associated with overexpression of HSIX1: a possible mechanism of breast carcinogenesis .
Author Ford HL, Kabingu EN, Bump EA, Mutter GL and Pardee AB.
Journal Proc. Natl. Acad. Sci. U.S.A. 95 (21), 12608-12613 (1998)
Title Cloning of the human SIX1 gene and its assignment to chromosome 14 .
Author Boucher CA, Carey N, Edwards YH, Siciliano MJ and Johnson KJ.
Journal Genomics 33 (1), 140-142 (1996)
Title Homeobox genes and connective tissue patterning .
Author Oliver G, Wehr R, Jenkins NA, Copeland NG, Cheyette BN, Hartenstein V, Zipursky SL and Gruss P.
Journal Development 121 (3), 693-705 (1995)
Title Deafness and Hereditary Hearing Loss Overview .
Author Smith,R.J.H., Shearer,A.E., Hildebrand,M.S. and Van Camp,G.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Branchiootorenal Spectrum Disorders .
Author Smith,R.J.H.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.