• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tubulin, alpha 4a (TUBA4A), mRNA.


RefSeq Accession Definition Services Price Order
NM_006000 Homo sapiens tubulin, alpha 4a (TUBA4A), mRNA. ORF Sequence $390.63
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_006000.1, 17921988
Length 1514 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens tubulin, alpha 4a (TUBA4A), mRNA.
Product tubulin alpha-4A chain
Comment

Summary: Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene encodes an alpha tubulin that is a highly conserved homolog of a rat testis-specific alpha tubulin. [provided by RefSeq, Jul 2008].

RefSeq NP_005991.1
CDS 59..1405
Misc Feature(1)35..37
Misc Feature(2)35..37
Misc Feature(3)59..1402
Misc Feature(4)59..1402
Misc Feature(5)62..1363
Misc Feature(6)order(62..64,653..655,815..820,824..832,836..841,
Misc Feature(7)order(86..94,101..106,263..271,278..280,353..361,476..496,
Misc Feature(8)176..178
Misc Feature(9)176..178
Misc Feature(10)200..202
Misc Feature(11)200..202
Misc Feature(12)order(272..277,356..364,371..373,599..601,605..607,
Misc Feature(13)872..874
Misc Feature(14)1127..1129
Misc Feature(15)1352..1354
Exon (1)1..61
Gene:TUBA4A
Gene Synonym:H2-ALPHA; TUBA1
Exon (2)62..284
Gene:TUBA4A
Gene Synonym:H2-ALPHA; TUBA1
Exon (3)285..433
Gene:TUBA4A
Gene Synonym:H2-ALPHA; TUBA1
Exon (4)434..1478
Gene:TUBA4A
Gene Synonym:H2-ALPHA; TUBA1
Translation MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGK HVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLD RIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPP TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE AREDMAALEKDYEEVGIDSYEDEDEGEE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(38)-g, cdbSNP:200129330
complement(56)-t, gdbSNP:200615683
complement(100)-dbSNP:
complement(100)-g, adbSNP:138241750
complement(124)-t, cdbSNP:141429751
complement(142)-g, adbSNP:145576984
complement(183)-g, adbSNP:201865832
complement(193)-t, gdbSNP:11556348
complement(196)-g, adbSNP:140319726
complement(328)-dbSNP:
complement(328)-g, adbSNP:45571337
complement(370)-c, adbSNP:11556347
complement(382)-g, adbSNP:199579096
complement(386)-t, cdbSNP:200651096
complement(387)-g, adbSNP:201172087
complement(390)-t, cdbSNP:201649283
complement(707)-t, gdbSNP:80231183
complement(712)-g, adbSNP:141146222
complement(720)-t, cdbSNP:199826343
complement(785)-g, adbSNP:199881197
complement(787)-g, adbSNP:190009503
complement(839)-g, adbSNP:147946711
complement(849)-t, cdbSNP:141069951
complement(907)-g, adbSNP:149475041
complement(967)-t, cdbSNP:141922502
complement(1057)-g, adbSNP:147351423
complement(1315)-g, adbSNP:199590938
complement(1342)-t, gdbSNP:14760
complement(1345)-g, cdbSNP:201092237
complement(1387)-g, adbSNP:1063394
complement(1413)-t, cdbSNP:142720001
complement(1453)-g, adbSNP:11556349
Gene SymbolTUBA4A
Gene SynonymH2-ALPHA; TUBA1
Chromosome2
Locus Map2q35
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_006000 Homo sapiens tubulin, alpha 4a (TUBA4A), mRNA. Full Length $439.06
ORF Sequence $390.63
Title Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration .
Author Martins-de-Souza,D., Guest,P.C., Mann,D.M., Roeber,S., Rahmoune,H., Bauder,C., Kretzschmar,H., Volk,B., Baborie,A. and Bahn,S.
Journal J. Proteome Res. 11 (4), 2533-2543 (2012)
Title Postmortem proteomic analysis in human amygdala of drug addicts: possible impact of tubulin on drug-abusing behavior .
Author Zill,P., Vielsmeier,V., Buttner,A., Eisenmenger,W., Siedler,F., Scheffer,B., Moller,H.J. and Bondy,B.
Journal Eur Arch Psychiatry Clin Neurosci 261 (2), 121-131 (2011)
Title Dynamic subunit exchange and the regulation of microtubule assembly by the stress response protein human alphaB crystallin .
Author Houck,S.A. and Clark,J.I.
Journal PLoS ONE 5 (7), E11795 (2010)
Title The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature .
Author Zhao,J., Li,M., Bradfield,J.P., Zhang,H., Mentch,F.D., Wang,K., Sleiman,P.M., Kim,C.E., Glessner,J.T., Hou,C., Keating,B.J., Thomas,K.A., Garris,M.L., Deliard,S., Frackelton,E.C., Otieno,F.G., Chiavacci,R.M., Berkowitz,R.I., Hakonarson,H. and Grant,S.F.
Journal BMC Med. Genet. 11, 96 (2010)
Title Many sequence variants affecting diversity of adult human height .
Author Gudbjartsson,D.F., Walters,G.B., Thorleifsson,G., Stefansson,H., Halldorsson,B.V., Zusmanovich,P., Sulem,P., Thorlacius,S., Gylfason,A., Steinberg,S., Helgadottir,A., Ingason,A., Steinthorsdottir,V., Olafsdottir,E.J., Olafsdottir,G.H., Jonsson,T., Borch-Johnsen,K., Hansen,T., Andersen,G., Jorgensen,T., Pedersen,O., Aben,K.K., Witjes,J.A., Swinkels,D.W., den Heijer,M., Franke,B., Verbeek,A.L., Becker,D.M., Yanek,L.R., Becker,L.C., Tryggvadottir,L., Rafnar,T., Gulcher,J., Kiemeney,L.A., Kong,A., Thorsteinsdottir,U. and Stefansson,K.
Journal Nat. Genet. 40 (5), 609-615 (2008)
Title The 93-kDa glycine receptor-associated protein binds to tubulin .
Author Kirsch,J., Langosch,D., Prior,P., Littauer,U.Z., Schmitt,B. and Betz,H.
Journal J. Biol. Chem. 266 (33), 22242-22245 (1991)
Title Alternative 5' exons either provide or deny an initiator methionine codon to the same alpha-tubulin coding region .
Author Dobner,P.R., Kislauskis,E., Wentworth,B.M. and Villa-Komaroff,L.
Journal Nucleic Acids Res. 15 (1), 199-218 (1987)
Title Six mouse alpha-tubulin mRNAs encode five distinct isotypes: testis-specific expression of two sister genes .
Author Villasante,A., Wang,D., Dobner,P., Dolph,P., Lewis,S.A. and Cowan,N.J.
Journal Mol. Cell. Biol. 6 (7), 2409-2419 (1986)
Title Structural features and restricted expression of a human alpha-tubulin gene .
Author Hall,J.L. and Cowan,N.J.
Journal Nucleic Acids Res. 13 (1), 207-223 (1985)
Title Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa .
Author Gogstad,G.O., Hagen,I., Korsmo,R. and Solum,N.O.
Journal Biochim. Biophys. Acta 670 (2), 150-162 (1981)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878