• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tubulin, alpha 4a (TUBA4A), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_006000 Homo sapiens tubulin, alpha 4a (TUBA4A), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 12

*Business Day

Related Services

RefSeq Version NM_006000.2, 514052657
Length 2076 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens tubulin, alpha 4a (TUBA4A), transcript variant 1, mRNA.
Product tubulin alpha-4A chain isoform 1
Comment

Summary: Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene encodes an alpha tubulin that is a highly conserved homolog of a rat testis-specific alpha tubulin. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2013].


Transcript Variant: This variant (1) encodes the longer isoform (1).

RefSeq NP_005991.1
CDS 89..1435
Misc Feature(1)65..67
Misc Feature(2)65..67
Misc Feature(3)89..1432
Misc Feature(4)89..1432
Misc Feature(5)92..1393
Misc Feature(6)order(92..94,683..685,845..850,854..862,866..871,
Misc Feature(7)order(116..124,131..136,293..301,308..310,383..391,
Misc Feature(8)206..208
Misc Feature(9)206..208
Misc Feature(10)230..232
Misc Feature(11)230..232
Misc Feature(12)order(302..307,386..394,401..403,629..631,635..637,
Misc Feature(13)902..904
Misc Feature(14)1157..1159
Misc Feature(15)1382..1384
Exon (1)1..91
Gene:TUBA4A
Gene Synonym:H2-ALPHA; TUBA1
Exon (2)92..314
Gene:TUBA4A
Gene Synonym:H2-ALPHA; TUBA1
Exon (3)315..463
Gene:TUBA4A
Gene Synonym:H2-ALPHA; TUBA1
Exon (4)464..2076
Gene:TUBA4A
Gene Synonym:H2-ALPHA; TUBA1
Translation MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGK HVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLD RIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPP TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE AREDMAALEKDYEEVGIDSYEDEDEGEE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(68)-g, cdbSNP:200129330
complement(79)-g, adbSNP:377724136
complement(86)-t, gdbSNP:200615683
complement(130)-dbSNP:
complement(130)-g, adbSNP:138241750
complement(154)-t, cdbSNP:141429751
complement(172)-g, adbSNP:145576984
complement(175)-t, cdbSNP:373338390
complement(193)-g, cdbSNP:368969801
complement(213)-g, adbSNP:201865832
223+g, tdbSNP:11556348
complement(223)-c, adbSNP:386519234
complement(226)-g, adbSNP:140319726
complement(271)-g, adbSNP:376398028
complement(291)-g, adbSNP:372756767
complement(358)-dbSNP:
complement(358)-g, adbSNP:45571337
400+a, cdbSNP:11556347
complement(412)-g, adbSNP:199579096
complement(416)-t, cdbSNP:200651096
complement(417)-g, adbSNP:201172087
complement(420)-t, cdbSNP:201649283
complement(496)-dbSNP:
complement(496)-t, cdbSNP:372079932
complement(553)-t, cdbSNP:368461384
complement(610)-g, adbSNP:374107920
complement(732)-t, cdbSNP:371074506
complement(737)-t, gdbSNP:80231183
complement(742)-g, adbSNP:141146222
complement(750)-t, cdbSNP:199826343
complement(812)-g, adbSNP:370939488
complement(815)-g, adbSNP:199881197
complement(817)-g, adbSNP:190009503
complement(869)-g, adbSNP:147946711
complement(879)-t, cdbSNP:141069951
complement(914)-t, cdbSNP:377319362
complement(937)-g, adbSNP:149475041
complement(997)-t, cdbSNP:141922502
complement(1075)-g, adbSNP:372891488
complement(1076)-t, cdbSNP:369027314
complement(1087)-g, adbSNP:147351423
complement(1211)-t, cdbSNP:377431750
complement(1234)-g, adbSNP:373071036
complement(1235)-t, cdbSNP:368743618
complement(1345)-g, adbSNP:199590938
1372+g, tdbSNP:14760
complement(1372)-c, adbSNP:386533590
complement(1375)-g, cdbSNP:201092237
complement(1407)-t, cdbSNP:376008810
1417+a, gdbSNP:1063394
complement(1443)-t, cdbSNP:142720001
complement(1462)-g, adbSNP:369629125
complement(1482)-g, adbSNP:376317489
complement(1483)-t, cdbSNP:386519235
complement(1483)-g, adbSNP:11556349
complement(1483)-g, adbSNP:76791099
complement(1594)-g, adbSNP:9808425
complement(1618)-g, adbSNP:369044508
complement(1635)-c, adbSNP:192126963
complement(1661)-g, adbSNP:188037939
complement(1679)-t, cdbSNP:371557574
complement(1690)-t, cdbSNP:74429631
complement(1749)-t, adbSNP:375486393
complement(1751)-t, gdbSNP:183276392
complement(1766)-g, adbSNP:376690665
complement(1807)-g, adbSNP:191481780
complement(1829)-t, gdbSNP:1054431
complement(1830)-t, cdbSNP:187700226
complement(1879)-g, adbSNP:138911012
complement(1900)-t, cdbSNP:146214371
complement(1981)-t, cdbSNP:183003213
Gene SymbolTUBA4A
Gene SynonymH2-ALPHA; TUBA1
Chromosome2
Locus Map2q35
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001278552 Homo sapiens tubulin, alpha 4a (TUBA4A), transcript variant 2, mRNA. On-demand $699.00 18
NM_006000 Homo sapiens tubulin, alpha 4a (TUBA4A), transcript variant 1, mRNA. In-stock $509.00 $460.00 12
XM_005246832 PREDICTED: Homo sapiens tubulin, alpha 4a (TUBA4A), transcript variant X1, mRNA. On-demand $699.00 18
Title Acetylated alpha-tubulin is reduced in individuals with poor sperm motility .
Author Bhagwat S, Dalvi V, Chandrasekhar D, Matthew T, Acharya K, Gajbhiye R, Kulkarni V, Sonawane S, Ghosalkar M and Parte P.
Journal Fertil. Steril. 101 (1), 95-104 (2014)
Title Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration .
Author Martins-de-Souza D, Guest PC, Mann DM, Roeber S, Rahmoune H, Bauder C, Kretzschmar H, Volk B, Baborie A and Bahn S.
Journal J. Proteome Res. 11 (4), 2533-2543 (2012)
Title Postmortem proteomic analysis in human amygdala of drug addicts: possible impact of tubulin on drug-abusing behavior .
Author Zill P, Vielsmeier V, Buttner A, Eisenmenger W, Siedler F, Scheffer B, Moller HJ and Bondy B.
Journal Eur Arch Psychiatry Clin Neurosci 261 (2), 121-131 (2011)
Title Dynamic subunit exchange and the regulation of microtubule assembly by the stress response protein human alphaB crystallin .
Author Houck SA and Clark JI.
Journal PLoS ONE 5 (7), E11795 (2010)
Title The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature .
Author Zhao J, Li M, Bradfield JP, Zhang H, Mentch FD, Wang K, Sleiman PM, Kim CE, Glessner JT, Hou C, Keating BJ, Thomas KA, Garris ML, Deliard S, Frackelton EC, Otieno FG, Chiavacci RM, Berkowitz RI, Hakonarson H and Grant SF.
Journal BMC Med. Genet. 11, 96 (2010)
Title The 93-kDa glycine receptor-associated protein binds to tubulin .
Author Kirsch J, Langosch D, Prior P, Littauer UZ, Schmitt B and Betz H.
Journal J. Biol. Chem. 266 (33), 22242-22245 (1991)
Title Alternative 5' exons either provide or deny an initiator methionine codon to the same alpha-tubulin coding region .
Author Dobner,P.R., Kislauskis,E., Wentworth,B.M. and Villa-Komaroff,L.
Journal Nucleic Acids Res. 15 (1), 199-218 (1987)
Title Six mouse alpha-tubulin mRNAs encode five distinct isotypes: testis-specific expression of two sister genes .
Author Villasante,A., Wang,D., Dobner,P., Dolph,P., Lewis,S.A. and Cowan,N.J.
Journal Mol. Cell. Biol. 6 (7), 2409-2419 (1986)
Title Structural features and restricted expression of a human alpha-tubulin gene .
Author Hall,J.L. and Cowan,N.J.
Journal Nucleic Acids Res. 13 (1), 207-223 (1985)
Title Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa .
Author Gogstad,G.O., Hagen,I., Korsmo,R. and Solum,N.O.
Journal Biochim. Biophys. Acta 670 (2), 150-162 (1981)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.