• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tubulin, alpha 4a (TUBA4A), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_006000 Homo sapiens tubulin, alpha 4a (TUBA4A), mRNA. Full Lenth $439.06
ORF Sequence $390.63


RefSeq Version NM_006000.1, 17921988
Length 1514 bp
Structure linear
Update Date 11-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens tubulin, alpha 4a (TUBA4A), mRNA.
Product tubulin alpha-4A chain
Comment

Summary: Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene encodes an alpha tubulin that is a highly conserved homolog of a rat testis-specific alpha tubulin. [provided by RefSeq].

RefSeq NP_005991.1
CDS 59..1405
Exon (1)1..61
Exon (2)1..61
Exon (3)62..284
Exon (4)285..433
Exon (5)434..1478
Translation MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGK HVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLD RIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPP TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE AREDMAALEKDYEEVGIDSYEDEDEGEE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
193+g, tdbSNP:11556348
328+a, gdbSNP:45571337
370+a, cdbSNP:11556347
complement(707)-t, gdbSNP:80231183
785+c, tdbSNP:3731891
907+c, tdbSNP:3731893
1342+g, tdbSNP:14760
1387+a, gdbSNP:1063394
1453+a, gdbSNP:11556349
Gene SymbolTUBA4A
Gene SynonymFLJ30169; H2-ALPHA; TUBA1
Chromosome2
Locus Map2q35
All Transcripts NM_006000
Title Dynamic subunit exchange and the regulation of microtubule assembly by the stress response protein human alphaB crystallin .
Author Houck,S.A. and Clark,J.I.
Journal PLoS ONE 5 (7), E11795 (2010)
Title The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature .
Author Zhao,J., Li,M., Bradfield,J.P., Zhang,H., Mentch,F.D., Wang,K., Sleiman,P.M., Kim,C.E., Glessner,J.T., Hou,C., Keating,B.J., Thomas,K.A., Garris,M.L., Deliard,S., Frackelton,E.C., Otieno,F.G., Chiavacci,R.M., Berkowitz,R.I., Hakonarson,H. and Grant,S.F.
Journal BMC Med. Genet. 11, 96 (2010)
Title Many sequence variants affecting diversity of adult human height .
Author Gudbjartsson,D.F., Walters,G.B., Thorleifsson,G., Stefansson,H., Halldorsson,B.V., Zusmanovich,P., Sulem,P., Thorlacius,S., Gylfason,A., Steinberg,S., Helgadottir,A., Ingason,A., Steinthorsdottir,V., Olafsdottir,E.J., Olafsdottir,G.H., Jonsson,T., Borch-Johnsen,K., Hansen,T., Andersen,G., Jorgensen,T., Pedersen,O., Aben,K.K., Witjes,J.A., Swinkels,D.W., den Heijer,M., Franke,B., Verbeek,A.L., Becker,D.M., Yanek,L.R., Becker,L.C., Tryggvadottir,L., Rafnar,T., Gulcher,J., Kiemeney,L.A., Kong,A., Thorsteinsdottir,U. and Stefansson,K.
Journal Nat. Genet. 40 (5), 609-615 (2008)
Title The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation .
Author Petretti,C., Savoian,M., Montembault,E., Glover,D.M., Prigent,C. and Giet,R.
Journal EMBO Rep. 7 (4), 418-424 (2006)
Title Tubulin nitration in human gliomas .
Author Fiore,G., Di Cristo,C., Monti,G., Amoresano,A., Columbano,L., Pucci,P., Cioffi,F.A., Di Cosmo,A., Palumbo,A. and d'Ischia,M.
Journal Neurosci. Lett. 394 (1), 57-62 (2006)
Title The 93-kDa glycine receptor-associated protein binds to tubulin .
Author Kirsch,J., Langosch,D., Prior,P., Littauer,U.Z., Schmitt,B. and Betz,H.
Journal J. Biol. Chem. 266 (33), 22242-22245 (1991)
Title Alternative 5' exons either provide or deny an initiator methionine codon to the same alpha-tubulin coding region .
Author Dobner,P.R., Kislauskis,E., Wentworth,B.M. and Villa-Komaroff,L.
Journal Nucleic Acids Res. 15 (1), 199-218 (1987)
Title Six mouse alpha-tubulin mRNAs encode five distinct isotypes: testis-specific expression of two sister genes .
Author Villasante,A., Wang,D., Dobner,P., Dolph,P., Lewis,S.A. and Cowan,N.J.
Journal Mol. Cell. Biol. 6 (7), 2409-2419 (1986)
Title Structural features and restricted expression of a human alpha-tubulin gene .
Author Hall,J.L. and Cowan,N.J.
Journal Nucleic Acids Res. 13 (1), 207-223 (1985)
Title Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa .
Author Gogstad,G.O., Hagen,I., Korsmo,R. and Solum,N.O.
Journal Biochim. Biophys. Acta 670 (2), 150-162 (1981)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878