• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_006002 Homo sapiens ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), transcript variant 2, mRNA. GenEZ ORF Cloning In-stock $308.00 $259.00 10

*Business Day

Related Services

RefSeq Version NM_006002.4, 401709953
Length 972 bp
Structure linear
Update Date 20-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), transcript variant 2, mRNA.
Product ubiquitin carboxyl-terminal hydrolase isozyme L3 isoform 2
Comment

Summary: The protein encoded by this gene is a member of the deubiquitinating enzyme family. Members of this family are proteases that catalyze the removal of ubiquitin from polypeptides and are divided into five classes, depending on the mechanism of catalysis. This protein may hydrolyze the ubiquitinyl-N-epsilon amide bond of ubiquitinated proteins to regenerate ubiquitin for another catalytic cycle. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Aug 2012].


Transcript Variant: This variant (2) contains an alternate exon in the 5' coding region and initiates translation at an alternate start codon compared to variant 1. The encoded isoform (2) has a distinct N-terminus and is longer than isoform 1.

RefSeq NP_005993.1
CDS 72..764
Misc Feature(1)87..752
Misc Feature(2)87..752
Misc Feature(3)order(93..110,168..179,234..236,354..356,573..575,
Misc Feature(4)order(93..95,336..338,348..350,354..356,573..578)
Misc Feature(5)93..110
Misc Feature(6)294..296
Misc Feature(7)order(336..338,354..356,576..578,621..623)
Misc Feature(8)459..461
Misc Feature(9)525..548
Misc Feature(10)621..623
Misc Feature(11)726..743
Exon (1)1..113
Gene:UCHL3
Gene Synonym:UCH-L3
Exon (2)114..125
Gene:UCHL3
Gene Synonym:UCH-L3
Exon (3)126..254
Gene:UCHL3
Gene Synonym:UCH-L3
Exon (4)255..411
Gene:UCHL3
Gene Synonym:UCH-L3
Exon (5)412..497
Gene:UCHL3
Gene Synonym:UCH-L3
Exon (6)498..545
Gene:UCHL3
Gene Synonym:UCH-L3
Exon (7)546..621
Gene:UCHL3
Gene Synonym:UCH-L3
Exon (8)622..680
Gene:UCHL3
Gene Synonym:UCH-L3
Exon (9)681..972
Gene:UCHL3
Gene Synonym:UCH-L3
Translation MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITE KYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLK KFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHL YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
17..31+dbSNP:
17..31+, ggcggcggcggcgaadbSNP:149695719
17+, ggcggcggcggcgaadbSNP:67763278
26..40+, ggcgaaggcggcggcdbSNP:8192737
57+c, tdbSNP:201923490
58+c, tdbSNP:199605560
62+c, tdbSNP:7996485
66+a, gdbSNP:148862350
70+c, tdbSNP:138830150
106+a, gdbSNP:141970788
164+dbSNP:
164+c, tdbSNP:192624215
191+a, gdbSNP:111653662
229+g, tdbSNP:146293310
301+dbSNP:
301+g, tdbSNP:141870275
418+dbSNP:
418+c, gdbSNP:200965579
423+a, cdbSNP:12872971
472+a, gdbSNP:11555620
553+dbSNP:
553+a, gdbSNP:201962508
561+a, gdbSNP:200687621
575+a, tdbSNP:188855227
700+a, gdbSNP:150677527
701+a, gdbSNP:147520161
742+c, tdbSNP:139878255
858+g, tdbSNP:2274048
933+c, tdbSNP:112597363
Gene SymbolUCHL3
Gene SynonymUCH-L3
Chromosome13
Locus Map13q22.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001270952 Homo sapiens ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), transcript variant 1, mRNA. In-stock $308.00 $259.00 10
NM_006002 Homo sapiens ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), transcript variant 2, mRNA. In-stock $308.00 $259.00 10
Title Chalcone-based small-molecule inhibitors attenuate malignant phenotype via targeting deubiquitinating enzymes .
Author Issaenko,O.A. and Amerik,A.Y.
Journal Cell Cycle 11 (9), 1804-1817 (2012)
Title Contribution of active site glutamine to rate enhancement in ubiquitin C-terminal hydrolases .
Author Boudreaux,D.A., Chaney,J., Maiti,T.K. and Das,C.
Journal FEBS J. 279 (6), 1106-1118 (2012)
Title Targeting deubiquitinases enabled by chemical synthesis of proteins .
Author Ohayon,S., Spasser,L., Aharoni,A. and Brik,A.
Journal J. Am. Chem. Soc. 134 (6), 3281-3289 (2012)
Title A novel RNAi lethality rescue screen to identify regulators of adipogenesis .
Author van Beekum,O., Gao,Y., Berger,R., Koppen,A. and Kalkhoven,E.
Journal PLoS ONE 7 (6), E37680 (2012)
Title Structure of the ubiquitin hydrolase UCH-L3 complexed with a suicide substrate .
Author Misaghi,S., Galardy,P.J., Meester,W.J., Ovaa,H., Ploegh,H.L. and Gaudet,R.
Journal J. Biol. Chem. 280 (2), 1512-1520 (2005)
Title Molecular profiling of the immune response in colon cancer using protein microarrays: occurrence of autoantibodies to ubiquitin C-terminal hydrolase L3 .
Author Nam,M.J., Madoz-Gurpide,J., Wang,H., Lescure,P., Schmalbach,C.E., Zhao,R., Misek,D.E., Kuick,R., Brenner,D.E. and Hanash,S.M.
Journal Proteomics 3 (11), 2108-2115 (2003)
Title The binding site for UCH-L3 on ubiquitin: mutagenesis and NMR studies on the complex between ubiquitin and UCH-L3 .
Author Wilkinson,K.D., Laleli-Sahin,E., Urbauer,J., Larsen,C.N., Shih,G.H., Haas,A.L., Walsh,S.T. and Wand,A.J.
Journal J. Mol. Biol. 291 (5), 1067-1077 (1999)
Title Cleavage of the C-terminus of NEDD8 by UCH-L3 .
Author Wada,H., Kito,K., Caskey,L.S., Yeh,E.T. and Kamitani,T.
Journal Biochem. Biophys. Res. Commun. 251 (3), 688-692 (1998)
Title Crystal structure of a deubiquitinating enzyme (human UCH-L3) at 1.8 A resolution .
Author Johnston,S.C., Larsen,C.N., Cook,W.J., Wilkinson,K.D. and Hill,C.P.
Journal EMBO J. 16 (13), 3787-3796 (1997)
Title The neuron-specific protein PGP 9.5 is a ubiquitin carboxyl-terminal hydrolase .
Author Wilkinson,K.D., Lee,K.M., Deshpande,S., Duerksen-Hughes,P., Boss,J.M. and Pohl,J.
Journal Science 246 (4930), 670-673 (1989)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.