• THAT   AND
  • THAT   AND


Homo sapiens ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_006002 Homo sapiens ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), mRNA. Full Lenth $260.71
ORF Sequence $200.97


RefSeq Version NM_006002.3, 37059734
Length 899 bp
Structure linear
Update Date 09-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), mRNA.
Product ubiquitin carboxyl-terminal hydrolase isozyme L3
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC018125.2. On Sep 30, 2003 this sequence version replaced gi:20149578.

RefSeq NP_005993.1
CDS 31..723
Exon (1)1..72
Exon (2)1..72
Exon (3)73..84
Exon (4)85..213
Exon (5)214..370
Exon (6)371..456
Exon (7)457..504
Exon (8)505..580
Exon (9)581..639
Exon (10)640..844
Translation MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITE KYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLK KFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHL YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
21+c, tdbSNP:7996485
150+a, gdbSNP:111653662
382+a, cdbSNP:12872971
431+a, gdbSNP:11555620
817+g, tdbSNP:2274048
Gene SymbolUCHL3
Gene SynonymUCH-L3
Chromosome13
Locus Map13q22.2
All Transcripts NM_006002
Title Defining the human deubiquitinating enzyme interaction landscape .
Author Sowa,M.E., Bennett,E.J., Gygi,S.P. and Harper,J.W.
Journal Cell 138 (2), 389-403 (2009)
Title Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects .
Author Saito,A., Kawamoto,M. and Kamatani,N.
Journal J. Hum. Genet. 54 (6), 317-323 (2009)
Title Untangling the folding mechanism of the 5(2)-knotted protein UCH-L3 .
Author Andersson,F.I., Pina,D.G., Mallam,A.L., Blaser,G. and Jackson,S.E.
Journal FEBS J. 276 (9), 2625-2635 (2009)
Title Ubiquitin dimers control the hydrolase activity of UCH-L3 .
Author Setsuie,R., Sakurai,M., Sakaguchi,Y. and Wada,K.
Journal Neurochem. Int. 54 (5-6), 314-321 (2009)
Title Backbone 1H, 13C, and 15N resonance assignments for the 26-kD human de-ubiquitinating enzyme UCH-L3 .
Author Harris,R., Eidhoff,U., Vinzenz,D., Renatus,M., Gerhartz,B., Hommel,U. and Driscoll,P.C.
Journal Biomol NMR Assign 1 (1), 51-53 (2007)
Title Molecular cloning of chick UCH-6 which shares high similarity with human UCH-L3: its unusual substrate specificity and tissue distribution .
Author Baek,S.H., Yoo,Y.J., Tanaka,K. and Chung,C.H.
Journal Biochem. Biophys. Res. Commun. 264 (1), 235-240 (1999)
Title The binding site for UCH-L3 on ubiquitin: mutagenesis and NMR studies on the complex between ubiquitin and UCH-L3 .
Author Wilkinson,K.D., Laleli-Sahin,E., Urbauer,J., Larsen,C.N., Shih,G.H., Haas,A.L., Walsh,S.T. and Wand,A.J.
Journal J. Mol. Biol. 291 (5), 1067-1077 (1999)
Title Cleavage of the C-terminus of NEDD8 by UCH-L3 .
Author Wada,H., Kito,K., Caskey,L.S., Yeh,E.T. and Kamitani,T.
Journal Biochem. Biophys. Res. Commun. 251 (3), 688-692 (1998)
Title Crystal structure of a deubiquitinating enzyme (human UCH-L3) at 1.8 A resolution .
Author Johnston,S.C., Larsen,C.N., Cook,W.J., Wilkinson,K.D. and Hill,C.P.
Journal EMBO J. 16 (13), 3787-3796 (1997)
Title The neuron-specific protein PGP 9.5 is a ubiquitin carboxyl-terminal hydrolase .
Author Wilkinson,K.D., Lee,K.M., Deshpande,S., Duerksen-Hughes,P., Boss,J.M. and Pohl,J.
Journal Science 246 (4930), 670-673 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878