• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu56052 Homo sapiens ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), transcript variant 2, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu56052C Homo sapiens ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), transcript variant 2, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_006002.4, 401709953
Length 693 bp
Structure linear
Update Date 10-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), transcript variant 2, mRNA.
Product ubiquitin carboxyl-terminal hydrolase isozyme L3 isoform 2
Comment

Summary: The protein encoded by this gene is a member of the deubiquitinating enzyme family. Members of this family are proteases that catalyze the removal of ubiquitin from polypeptides and are divided into five classes, depending on the mechanism of catalysis. This protein may hydrolyze the ubiquitinyl-N-epsilon amide bond of ubiquitinated proteins to regenerate ubiquitin for another catalytic cycle. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Aug 2012].


Transcript Variant: This variant (2) contains an alternate exon in the 5' coding region and initiates translation at an alternate start codon compared to variant 1. The encoded isoform (2) has a distinct N-terminus and is longer than isoform 1.

RefSeq NP_005993.1
CDS 72..764
Misc Feature(1)87..752
Misc Feature(2)87..752
Misc Feature(3)order(93..110,168..179,234..236,354..356,573..575,
Misc Feature(4)order(93..95,336..338,348..350,354..356,573..578)
Misc Feature(5)93..110
Misc Feature(6)294..296
Misc Feature(7)order(336..338,354..356,576..578,621..623)
Misc Feature(8)459..461
Misc Feature(9)525..548
Misc Feature(10)621..623
Misc Feature(11)726..743
Exon (1)1..113
Gene:UCHL3
Gene Synonym:UCH-L3
Exon (2)114..125
Gene:UCHL3
Gene Synonym:UCH-L3
Exon (3)126..254
Gene:UCHL3
Gene Synonym:UCH-L3
Exon (4)255..411
Gene:UCHL3
Gene Synonym:UCH-L3
Exon (5)412..497
Gene:UCHL3
Gene Synonym:UCH-L3
Exon (6)498..545
Gene:UCHL3
Gene Synonym:UCH-L3
Exon (7)546..621
Gene:UCHL3
Gene Synonym:UCH-L3
Exon (8)622..680
Gene:UCHL3
Gene Synonym:UCH-L3
Exon (9)681..972
Gene:UCHL3
Gene Synonym:UCH-L3
Translation MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITE KYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLK KFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHL YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
17..31+dbSNP:
17..31+, ggcggcggcggcgaadbSNP:149695719
26..40+, ggcgaaggcggcggcdbSNP:8192737
46+c, gdbSNP:367636758
57+c, tdbSNP:201923490
58+c, tdbSNP:199605560
62+c, tdbSNP:7996485
66+a, gdbSNP:148862350
70+c, tdbSNP:138830150
106+a, gdbSNP:141970788
164+dbSNP:
164+c, tdbSNP:192624215
191+a, gdbSNP:111653662
201+a, gdbSNP:372889994
229+g, tdbSNP:146293310
287+dbSNP:
287+a, tdbSNP:376728987
301+g, tdbSNP:141870275
395+a, gdbSNP:376626341
418+dbSNP:
418+c, gdbSNP:200965579
423+a, cdbSNP:12872971
471+c, tdbSNP:374305257
472+a, gdbSNP:11555620
485+a, gdbSNP:377416621
549+dbSNP:
549+c, tdbSNP:375314560
553+a, gdbSNP:201962508
561+a, gdbSNP:200687621
575+a, tdbSNP:188855227
578+c, tdbSNP:371408920
700+a, gdbSNP:150677527
701+a, gdbSNP:147520161
722+c, tdbSNP:376497370
742+c, tdbSNP:139878255
800+a, tdbSNP:371424841
858+g, tdbSNP:2274048
933+c, tdbSNP:112597363
Gene SymbolUCHL3
Gene SynonymUCH-L3
Chromosome13
Locus Map13q22.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001270952 Homo sapiens ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), transcript variant 1, mRNA. In-stock $99.00 5-7
XM_005266514 PREDICTED: Homo sapiens ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), transcript variant X1, mRNA. On-demand $159.00 7-9
XM_006719863 PREDICTED: Homo sapiens ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), transcript variant X3, mRNA. On-demand $159.00 7-9
XM_005266515 PREDICTED: Homo sapiens ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), transcript variant X2, mRNA. On-demand $159.00 7-9
NM_006002 Homo sapiens ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (UCHL3), transcript variant 2, mRNA. In-stock $99.00 5-7
Title Genome-wide association study in a Chinese population with diabetic retinopathy .
Author Sheu WH, Kuo JZ, Lee IT, Hung YJ, Lee WJ, Tsai HY, Wang JS, Goodarzi MO, Klein R, Klein BE, Ipp E, Lin SY, Guo X, Hsieh CH, Taylor KD, Fu CP, Rotter JI and Chen YD.
Journal Hum. Mol. Genet. 22 (15), 3165-3173 (2013)
Title Chalcone-based small-molecule inhibitors attenuate malignant phenotype via targeting deubiquitinating enzymes .
Author Issaenko OA and Amerik AY.
Journal Cell Cycle 11 (9), 1804-1817 (2012)
Title Contribution of active site glutamine to rate enhancement in ubiquitin C-terminal hydrolases .
Author Boudreaux DA, Chaney J, Maiti TK and Das C.
Journal FEBS J. 279 (6), 1106-1118 (2012)
Title A novel RNAi lethality rescue screen to identify regulators of adipogenesis .
Author van Beekum O, Gao Y, Berger R, Koppen A and Kalkhoven E.
Journal PLoS ONE 7 (6), E37680 (2012)
Title Structure of the ubiquitin hydrolase UCH-L3 complexed with a suicide substrate .
Author Misaghi S, Galardy PJ, Meester WJ, Ovaa H, Ploegh HL and Gaudet R.
Journal J. Biol. Chem. 280 (2), 1512-1520 (2005)
Title Molecular profiling of the immune response in colon cancer using protein microarrays: occurrence of autoantibodies to ubiquitin C-terminal hydrolase L3 .
Author Nam MJ, Madoz-Gurpide J, Wang H, Lescure P, Schmalbach CE, Zhao R, Misek DE, Kuick R, Brenner DE and Hanash SM.
Journal Proteomics 3 (11), 2108-2115 (2003)
Title The binding site for UCH-L3 on ubiquitin: mutagenesis and NMR studies on the complex between ubiquitin and UCH-L3 .
Author Wilkinson KD, Laleli-Sahin E, Urbauer J, Larsen CN, Shih GH, Haas AL, Walsh ST and Wand AJ.
Journal J. Mol. Biol. 291 (5), 1067-1077 (1999)
Title Cleavage of the C-terminus of NEDD8 by UCH-L3 .
Author Wada H, Kito K, Caskey LS, Yeh ET and Kamitani T.
Journal Biochem. Biophys. Res. Commun. 251 (3), 688-692 (1998)
Title Crystal structure of a deubiquitinating enzyme (human UCH-L3) at 1.8 A resolution .
Author Johnston SC, Larsen CN, Cook WJ, Wilkinson KD and Hill CP.
Journal EMBO J. 16 (13), 3787-3796 (1997)
Title The neuron-specific protein PGP 9.5 is a ubiquitin carboxyl-terminal hydrolase .
Author Wilkinson KD, Lee KM, Deshpande S, Duerksen-Hughes P, Boss JM and Pohl J.
Journal Science 246 (4930), 670-673 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.