• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens zinc finger and BTB domain containing 16 (ZBTB16), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu45862 Homo sapiens zinc finger and BTB domain containing 16 (ZBTB16), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu45862C Homo sapiens zinc finger and BTB domain containing 16 (ZBTB16), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_006006.4, 66932930
Length 2022 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens zinc finger and BTB domain containing 16 (ZBTB16), transcript variant 1, mRNA.
Product zinc finger and BTB domain-containing protein 16
Comment

Summary: This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longest transcript. Variants 1 and 2 encode the same protein.

RefSeq NP_005997.2
CDS 265..2286
Misc Feature(1)247..249
Misc Feature(2)337..639
Misc Feature(3)337..639
Misc Feature(4)988..990
Misc Feature(5)1444..1449
Misc Feature(6)<1606..2130
Misc Feature(7)1816..1884
Misc Feature(8)1858..1929
Misc Feature(9)1945..2016
Misc Feature(10)2029..2094
Exon (1)1..174
Gene:ZBTB16
Gene Synonym:PLZF; ZNF145
Exon (2)175..1532
Gene:ZBTB16
Gene Synonym:PLZF; ZNF145
Exon (3)1533..1630
Gene:ZBTB16
Gene Synonym:PLZF; ZNF145
Exon (4)1631..1717
Gene:ZBTB16
Gene Synonym:PLZF; ZNF145
Exon (5)1718..1888
Gene:ZBTB16
Gene Synonym:PLZF; ZNF145
Exon (6)1889..2056
Gene:ZBTB16
Gene Synonym:PLZF; ZNF145
Exon (7)2057..2407
Gene:ZBTB16
Gene Synonym:PLZF; ZNF145
Translation MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK MLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPM VDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAE VKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE ESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQP ALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH TGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPD WRIEKTYLYLCYV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
110+dbSNP:
110+c, tdbSNP:117941637
147+c, tdbSNP:373387180
215+dbSNP:
215+a, gdbSNP:371858413
254+a, tdbSNP:371403983
264+a, cdbSNP:200061176
308+a, gdbSNP:368808235
309+c, tdbSNP:114873121
314..315+, ccdbSNP:4020462
317+c, tdbSNP:200118587
321+a, gdbSNP:142115592
354+c, tdbSNP:150708066
409+a, cdbSNP:200926841
471+c, tdbSNP:201372671
526+c, tdbSNP:112754090
552+a, gdbSNP:373752900
582+c, tdbSNP:367557148
597+c, tdbSNP:200027612
662+c, tdbSNP:370480903
663+a, gdbSNP:35616762
673+a, gdbSNP:368029529
678+c, tdbSNP:147951342
690+c, tdbSNP:149620068
700+c, gdbSNP:116000851
706+c, tdbSNP:368725888
721+c, gdbSNP:200811309
753+c, tdbSNP:141895562
754+a, gdbSNP:372617173
775+c, gdbSNP:374962005
801+c, tdbSNP:368971745
829+a, gdbSNP:111746546
865+a, gdbSNP:111515613
928+g, tdbSNP:373854559
936+c, g, tdbSNP:35784831
965+a, gdbSNP:377612552
1040+c, tdbSNP:147732000
1044+c, tdbSNP:149153164
1077+a, gdbSNP:200225387
1125+c, tdbSNP:373185527
1187+a, cdbSNP:199676604
1203+c, tdbSNP:143295857
1234+c, gdbSNP:377294039
1269+c, tdbSNP:113757018
1270+a, gdbSNP:140433448
1286+a, gdbSNP:188510268
1293+c, tdbSNP:145655784
1294+a, gdbSNP:373798357
1300+c, tdbSNP:376003797
1311+a, gdbSNP:200705288
1335+c, tdbSNP:138118636
1336+a, gdbSNP:142709090
1376+a, gdbSNP:370641059
1396+a, gdbSNP:374279135
1422+c, tdbSNP:116451759
1426+c, tdbSNP:144726594
1435+c, tdbSNP:368196682
1437+c, gdbSNP:371963458
1440+c, tdbSNP:138594849
1447+a, gdbSNP:149262112
1464+g, tdbSNP:207472352
1499+a, gdbSNP:368472066
1512+c, tdbSNP:116066082
1543+dbSNP:
1543+a, gdbSNP:371953230
1557+c, gdbSNP:375573362
1560+c, tdbSNP:148436647
1582+c, tdbSNP:141621748
1605+a, gdbSNP:369917864
1643+dbSNP:
1643+c, tdbSNP:147151121
1662+c, tdbSNP:116547293
1677+a, gdbSNP:202099154
1731+dbSNP:
1731+c, tdbSNP:140189842
1741+c, tdbSNP:375570317
1767+g, tdbSNP:145667225
1776+a, gdbSNP:117928729
1792+a, gdbSNP:143447302
1806+c, tdbSNP:147709798
1878+c, tdbSNP:139901986
1890+c, tdbSNP:111400906
1944+a, cdbSNP:145751819
1953+a, cdbSNP:370528130
1963+a, cdbSNP:115957435
1987+a, gdbSNP:145635689
2003+a, gdbSNP:1047222
2113+dbSNP:
2113+a, gdbSNP:121434606
2127+c, gdbSNP:376061668
2133+a, gdbSNP:202060139
2241+c, tdbSNP:201532309
2259+a, gdbSNP:114107235
2260+a, tdbSNP:370636939
2296+c, tdbSNP:377609979
2299+a, gdbSNP:371293614
2301+c, tdbSNP:3088357
2302+a, gdbSNP:368652898
2307+c, tdbSNP:201739085
2310+c, tdbSNP:115496918
2311+a, gdbSNP:373656983
2318+g, tdbSNP:111960851
2335+c, tdbSNP:374340897
2346+c, tdbSNP:58686003
2380..2381+, adbSNP:113522699
2392+c, gdbSNP:11214915
Gene SymbolZBTB16
Gene SynonymPLZF; ZNF145
Chromosome11
Locus Map11q23.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001018011 Homo sapiens zinc finger and BTB domain containing 16 (ZBTB16), transcript variant 2, mRNA. In-stock $99.00 5-7
NM_006006 Homo sapiens zinc finger and BTB domain containing 16 (ZBTB16), transcript variant 1, mRNA. In-stock $99.00 5-7
XM_006718899 PREDICTED: Homo sapiens zinc finger and BTB domain containing 16 (ZBTB16), transcript variant X3, mRNA. On-demand $219.00 7-9
XM_005271658 PREDICTED: Homo sapiens zinc finger and BTB domain containing 16 (ZBTB16), transcript variant X2, mRNA. On-demand $219.00 7-9
Title Hypermethylation reduces expression of tumor-suppressor PLZF and regulates proliferation and apoptosis in non-small-cell lung cancers .
Author Wang X, Wang L, Guo S, Bao Y, Ma Y, Yan F, Xu K, Xu Z, Jin L, Lu D, Xu J and Wang JC.
Journal FASEB J. 27 (10), 4194-4203 (2013)
Title RARalpha-PLZF oncogene inhibits C/EBPalpha function in myeloid cells .
Author Girard N, Tremblay M, Humbert M, Grondin B, Haman A, Labrecque J, Chen B, Chen Z, Chen SJ and Hoang T.
Journal Proc. Natl. Acad. Sci. U.S.A. 110 (33), 13522-13527 (2013)
Title Promyelocytic leukemia zinc finger and histone H1.5 differentially stain low- and high-grade pulmonary neuroendocrine tumors: a pilot immunohistochemical study .
Author Hechtman JF, Beasley MB, Kinoshita Y, Ko HM, Hao K and Burstein DE.
Journal Hum. Pathol. 44 (7), 1400-1405 (2013)
Title Identification of a novel promyelocytic leukemia zinc-finger isoform required for colorectal cancer cell growth and survival .
Author Jones C, St-Jean S, Frechette I, Bergeron D, Rivard N and Boudreau F.
Journal Int. J. Cancer 133 (1), 58-66 (2013)
Title Human iNKT and MAIT cells exhibit a PLZF-dependent proapoptotic propensity that is counterbalanced by XIAP .
Author Gerart S, Siberil S, Martin E, Lenoir C, Aguilar C, Picard C, Lantz O, Fischer A and Latour S.
Journal Blood 121 (4), 614-623 (2013)
Title SMRT corepressor interacts with PLZF and with the PML-retinoic acid receptor alpha (RARalpha) and PLZF-RARalpha oncoproteins associated with acute promyelocytic leukemia .
Author Hong SH, David G, Wong CW, Dejean A and Privalsky ML.
Journal Proc. Natl. Acad. Sci. U.S.A. 94 (17), 9028-9033 (1997)
Title Amino-terminal protein-protein interaction motif (POZ-domain) is responsible for activities of the promyelocytic leukemia zinc finger-retinoic acid receptor-alpha fusion protein .
Author Dong S, Zhu J, Reid A, Strutt P, Guidez F, Zhong HJ, Wang ZY, Licht J, Waxman S, Chomienne C, Chen Z, Zelent A and Chen SJ.
Journal Proc. Natl. Acad. Sci. U.S.A. 93 (8), 3624-3629 (1996)
Title Leukemia translocation gene, PLZF, is expressed with a speckled nuclear pattern in early hematopoietic progenitors .
Author Reid A, Gould A, Brand N, Cook M, Strutt P, Li J, Licht J, Waxman S, Krumlauf R and Zelent A.
Journal Blood 86 (12), 4544-4552 (1995)
Title Rearrangements of the retinoic acid receptor alpha and promyelocytic leukemia zinc finger genes resulting from t(11;17)(q23;q21) in a patient with acute promyelocytic leukemia .
Author Chen SJ, Zelent A, Tong JH, Yu HQ, Wang ZY, Derre J, Berger R, Waxman S and Chen Z.
Journal J. Clin. Invest. 91 (5), 2260-2267 (1993)
Title Fusion between a novel Kruppel-like zinc finger gene and the retinoic acid receptor-alpha locus due to a variant t(11;17) translocation associated with acute promyelocytic leukaemia .
Author Chen Z, Brand NJ, Chen A, Chen SJ, Tong JH, Wang ZY, Waxman S and Zelent A.
Journal EMBO J. 12 (3), 1161-1167 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.