• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens zinc finger and BTB domain containing 16 (ZBTB16), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_006006 Homo sapiens zinc finger and BTB domain containing 16 (ZBTB16), transcript variant 1, mRNA. ORF Sequence $586.38
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_006006.4, 66932930
Length 2417 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens zinc finger and BTB domain containing 16 (ZBTB16), transcript variant 1, mRNA.
Product zinc finger and BTB domain-containing protein 16
Comment

Summary: This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longest transcript. Variants 1 and 2 encode the same protein.

RefSeq NP_005997.2
CDS 265..2286
Misc Feature(1)247..249
Misc Feature(2)247..249
Misc Feature(3)337..630
Misc Feature(4)337..630
Misc Feature(5)988..990
Misc Feature(6)1444..1449
Misc Feature(7)<1606..2025
Misc Feature(8)1645..1713
Misc Feature(9)1816..1884
Misc Feature(10)1858..1929
Misc Feature(11)1945..2016
Misc Feature(12)2029..2094
Exon (1)1..174
Gene:ZBTB16
Gene Synonym:PLZF; ZNF145
Exon (2)175..1532
Gene:ZBTB16
Gene Synonym:PLZF; ZNF145
Exon (3)1533..1630
Gene:ZBTB16
Gene Synonym:PLZF; ZNF145
Exon (4)1631..1717
Gene:ZBTB16
Gene Synonym:PLZF; ZNF145
Exon (5)1718..1888
Gene:ZBTB16
Gene Synonym:PLZF; ZNF145
Exon (6)1889..2056
Gene:ZBTB16
Gene Synonym:PLZF; ZNF145
Exon (7)2057..2407
Gene:ZBTB16
Gene Synonym:PLZF; ZNF145
Translation MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK MLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPM VDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAE VKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE ESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQP ALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH TGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPD WRIEKTYLYLCYV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
110+dbSNP:
110+c, tdbSNP:117941637
264+a, cdbSNP:200061176
309+c, tdbSNP:114873121
312+, ccdbSNP:4020462
317+c, tdbSNP:200118587
321+a, gdbSNP:142115592
354+c, tdbSNP:150708066
409+a, cdbSNP:200926841
471+c, tdbSNP:201372671
526+c, tdbSNP:112754090
597+c, tdbSNP:200027612
651+c, tdbSNP:139048673
663+a, gdbSNP:35616762
678+c, tdbSNP:147951342
690+c, tdbSNP:149620068
700+c, gdbSNP:116000851
721+c, gdbSNP:200811309
753+c, tdbSNP:141895562
829+a, gdbSNP:111746546
865+a, gdbSNP:111515613
936+c, g, tdbSNP:35784831
1040+c, tdbSNP:147732000
1044+c, tdbSNP:149153164
1077+a, gdbSNP:200225387
1187+a, cdbSNP:199676604
1203+c, tdbSNP:143295857
1269+c, tdbSNP:113757018
1270+a, gdbSNP:140433448
1286+a, gdbSNP:188510268
1293+c, tdbSNP:145655784
1311+a, gdbSNP:200705288
1335+c, tdbSNP:138118636
1336+a, gdbSNP:142709090
1422+c, tdbSNP:116451759
1426+c, tdbSNP:144726594
1440+c, tdbSNP:138594849
1447+a, gdbSNP:149262112
1464+g, tdbSNP:207472352
1512+c, tdbSNP:116066082
1560+dbSNP:
1560+c, tdbSNP:148436647
1582+c, tdbSNP:141621748
1643+dbSNP:
1643+c, tdbSNP:147151121
1662+c, tdbSNP:116547293
1677+a, gdbSNP:202099154
1731+dbSNP:
1731+c, tdbSNP:140189842
1767+g, tdbSNP:145667225
1776+a, gdbSNP:117928729
1792+a, gdbSNP:143447302
1806+c, tdbSNP:147709798
1878+c, tdbSNP:139901986
1890+c, tdbSNP:111400906
1944+a, cdbSNP:145751819
1963+a, cdbSNP:115957435
1987+a, gdbSNP:145635689
2003+a, gdbSNP:1047222
2113+dbSNP:
2113+a, gdbSNP:121434606
2133+a, gdbSNP:202060139
2241+c, tdbSNP:201532309
2259+a, gdbSNP:114107235
2301+c, tdbSNP:3088357
2307+c, tdbSNP:201739085
2310+c, tdbSNP:115496918
2318+g, tdbSNP:111960851
2346+c, tdbSNP:58686003
2376..2377+, adbSNP:113522699
2392+c, gdbSNP:11214915
Gene SymbolZBTB16
Gene SynonymPLZF; ZNF145
Chromosome11
Locus Map11q23.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001018011 Homo sapiens zinc finger and BTB domain containing 16 (ZBTB16), transcript variant 2, mRNA. Full Length $655.98
ORF Sequence $586.38
NM_006006 Homo sapiens zinc finger and BTB domain containing 16 (ZBTB16), transcript variant 1, mRNA. Full Length $700.93
ORF Sequence $586.38
Title Human iNKT and MAIT cells exhibit a PLZF-dependent proapoptotic propensity that is counterbalanced by XIAP .
Author Gerart,S., Siberil,S., Martin,E., Lenoir,C., Aguilar,C., Picard,C., Lantz,O., Fischer,A. and Latour,S.
Journal Blood 121 (4), 614-623 (2013)
Title Expression of the promyelocytic leukemia zinc-finger in T-lymphoblastic lymphoma and leukemia has strong implications for their cellular origin and greater association with initial bone marrow involvement .
Author Jeon,Y.K., Go,H., Nam,S.J., Keam,B., Kim,T.M., Jung,K.C., Kang,H.J., Lee,D.S., Huh,J.R. and Park,S.H.
Journal Mod. Pathol. 25 (9), 1236-1245 (2012)
Title Far-infrared therapy induces the nuclear translocation of PLZF which inhibits VEGF-induced proliferation in human umbilical vein endothelial cells .
Author Hsu,Y.H., Chen,Y.C., Chen,T.H., Sue,Y.M., Cheng,T.H., Chen,J.R. and Chen,C.H.
Journal PLoS ONE 7 (1), E30674 (2012)
Title A naive-like population of human CD1d-restricted T cells expressing intermediate levels of promyelocytic leukemia zinc finger .
Author Constantinides,M.G., Picard,D., Savage,A.K. and Bendelac,A.
Journal J. Immunol. 187 (1), 309-315 (2011)
Title Altered development of NKT cells, gammadelta T cells, CD8 T cells and NK cells in a PLZF deficient patient .
Author Eidson,M., Wahlstrom,J., Beaulieu,A.M., Zaidi,B., Carsons,S.E., Crow,P.K., Yuan,J., Wolchok,J.D., Horsthemke,B., Wieczorek,D. and Sant'Angelo,D.B.
Journal PLoS ONE 6 (9), E24441 (2011)
Title SMRT corepressor interacts with PLZF and with the PML-retinoic acid receptor alpha (RARalpha) and PLZF-RARalpha oncoproteins associated with acute promyelocytic leukemia .
Author Hong,S.H., David,G., Wong,C.W., Dejean,A. and Privalsky,M.L.
Journal Proc. Natl. Acad. Sci. U.S.A. 94 (17), 9028-9033 (1997)
Title Amino-terminal protein-protein interaction motif (POZ-domain) is responsible for activities of the promyelocytic leukemia zinc finger-retinoic acid receptor-alpha fusion protein .
Author Dong,S., Zhu,J., Reid,A., Strutt,P., Guidez,F., Zhong,H.J., Wang,Z.Y., Licht,J., Waxman,S., Chomienne,C., Chen,Z., Zelent,A. and Chen,S.J.
Journal Proc. Natl. Acad. Sci. U.S.A. 93 (8), 3624-3629 (1996)
Title Leukemia translocation gene, PLZF, is expressed with a speckled nuclear pattern in early hematopoietic progenitors .
Author Reid,A., Gould,A., Brand,N., Cook,M., Strutt,P., Li,J., Licht,J., Waxman,S., Krumlauf,R. and Zelent,A.
Journal Blood 86 (12), 4544-4552 (1995)
Title Rearrangements of the retinoic acid receptor alpha and promyelocytic leukemia zinc finger genes resulting from t(11;17)(q23;q21) in a patient with acute promyelocytic leukemia .
Author Chen,S.J., Zelent,A., Tong,J.H., Yu,H.Q., Wang,Z.Y., Derre,J., Berger,R., Waxman,S. and Chen,Z.
Journal J. Clin. Invest. 91 (5), 2260-2267 (1993)
Title Fusion between a novel Kruppel-like zinc finger gene and the retinoic acid receptor-alpha locus due to a variant t(11;17) translocation associated with acute promyelocytic leukaemia .
Author Chen,Z., Brand,N.J., Chen,A., Chen,S.J., Tong,J.H., Wang,Z.Y., Waxman,S. and Zelent,A.
Journal EMBO J. 12 (3), 1161-1167 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878