Homo sapiens zinc finger and BTB domain containing 16 (ZBTB16), transcript variant 1, mRNA.
| RefSeq Version | NM_006006.4, 66932930 |
| Length | 2417 bp |
| Structure | linear |
| Update Date | 12-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens zinc finger and BTB domain containing 16 (ZBTB16), transcript variant 1, mRNA. |
| Product | zinc finger and BTB domain-containing protein 16 |
| Comment | Summary: This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longest transcript. Variants 1 and 2 encode the same protein. |
| RefSeq | NP_005997.2 |
| CDS | 265..2286 | Exon (1) | 1..174 | Exon (2) | 1..174 | Exon (3) | 175..1532 | Exon (4) | 1533..1630 | Exon (5) | 1631..1717 | Exon (6) | 1718..1888 | Exon (7) | 1889..2056 | Exon (8) | 2057..2407 |
| Translation | MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK
MLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPM
VDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAE
VKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE
ESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQP
ALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH
TGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK
PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPD
WRIEKTYLYLCYV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 110 | + | c, t | dbSNP:117941637 |
| 309 | + | c, t | dbSNP:114873121 |
| 314 | + | , cc | dbSNP:4020462 |
| 526 | + | c, t | dbSNP:112754090 |
| 663 | + | a, g | dbSNP:35616762 |
| 700 | + | c, g | dbSNP:116000851 |
| 829 | + | a, g | dbSNP:111746546 |
| 865 | + | a, g | dbSNP:111515613 |
| 936 | + | c, g | dbSNP:35784831 |
| 1269 | + | c, t | dbSNP:113757018 |
| 1422 | + | c, t | dbSNP:116451759 |
| 1512 | + | c, t | dbSNP:116066082 |
| 1662 | + | c, t | dbSNP:116547293 |
| 1776 | + | a, g | dbSNP:117928729 |
| 1890 | + | c, t | dbSNP:111400906 |
| 1963 | + | a, c | dbSNP:115957435 |
| 2003 | + | a, g | dbSNP:1047222 |
| 2113 | + | a, g | dbSNP:121434606 |
| 2259 | + | a, g | dbSNP:114107235 |
| 2301 | + | c, t | dbSNP:3088357 |
| 2307 | + | a, g | dbSNP:117593675 |
| 2310 | + | c, t | dbSNP:115496918 |
| 2318 | + | g, t | dbSNP:111960851 |
| 2346 | + | c, t | dbSNP:58686003 |
| 2380..2381 | + | , a | dbSNP:113522699 |
| 2392 | + | c, g | dbSNP:11214915 |
| Gene Symbol | ZBTB16 |
| Gene Synonym | PLZF; ZNF145 |
| Chromosome | 11 |
| Locus Map | 11q23.1 |
| All Transcripts | NM_006006 , NM_001018011 |
| Title | The Promyelocytic Leukemia Zinc Finger (PLZF) gene is a novel transcriptional target of the CCAAT-Displacement-protein (CUX1) repressor . |
| Author | Frechette,I., Darsigny,M., Brochu-Gaudreau,K., Jones,C. and Boudreau,F. |
| Journal | FEBS J. 277 (20), 4241-4253 (2010) |
| Title | Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study . |
| Author | Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S. |
| Journal | Diabetes Care 33 (10), 2250-2253 (2010) |
| Title | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score . |
| Author | Rose,J.E., Behm,F.M., Drgon,T., Johnson,C. and Uhl,G.R. |
| Journal | Mol. Med. 16 (7-8), 247-253 (2010) |
| Title | Generation of PLZF+ CD4+ T cells via MHC class II-dependent thymocyte-thymocyte interaction is a physiological process in humans . |
| Author | Lee,Y.J., Jeon,Y.K., Kang,B.H., Chung,D.H., Park,C.G., Shin,H.Y., Jung,K.C. and Park,S.H. |
| Journal | J. Exp. Med. 207 (1), 237-246 (2010) |
| Title | Application of gene network analysis techniques identifies AXIN1/PDIA2 and endoglin haplotypes associated with bicuspid aortic valve . |
| Author | Wooten,E.C., Iyer,L.K., Montefusco,M.C., Hedgepeth,A.K., Payne,D.D., Kapur,N.K., Housman,D.E., Mendelsohn,M.E. and Huggins,G.S. |
| Journal | PLoS ONE 5 (1), E8830 (2010) |
| Title | SMRT corepressor interacts with PLZF and with the PML-retinoic acid receptor alpha (RARalpha) and PLZF-RARalpha oncoproteins associated with acute promyelocytic leukemia . |
| Author | Hong,S.H., David,G., Wong,C.W., Dejean,A. and Privalsky,M.L. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 94 (17), 9028-9033 (1997) |
| Title | Amino-terminal protein-protein interaction motif (POZ-domain) is responsible for activities of the promyelocytic leukemia zinc finger-retinoic acid receptor-alpha fusion protein . |
| Author | Dong,S., Zhu,J., Reid,A., Strutt,P., Guidez,F., Zhong,H.J., Wang,Z.Y., Licht,J., Waxman,S., Chomienne,C., Chen,Z., Zelent,A. and Chen,S.J. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 93 (8), 3624-3629 (1996) |
| Title | Leukemia translocation gene, PLZF, is expressed with a speckled nuclear pattern in early hematopoietic progenitors . |
| Author | Reid,A., Gould,A., Brand,N., Cook,M., Strutt,P., Li,J., Licht,J., Waxman,S., Krumlauf,R. and Zelent,A. |
| Journal | Blood 86 (12), 4544-4552 (1995) |
| Title | Rearrangements of the retinoic acid receptor alpha and promyelocytic leukemia zinc finger genes resulting from t(11;17)(q23;q21) in a patient with acute promyelocytic leukemia . |
| Author | Chen,S.J., Zelent,A., Tong,J.H., Yu,H.Q., Wang,Z.Y., Derre,J., Berger,R., Waxman,S. and Chen,Z. |
| Journal | J. Clin. Invest. 91 (5), 2260-2267 (1993) |
| Title | Fusion between a novel Kruppel-like zinc finger gene and the retinoic acid receptor-alpha locus due to a variant t(11;17) translocation associated with acute promyelocytic leukaemia . |
| Author | Chen,Z., Brand,N.J., Chen,A., Chen,S.J., Tong,J.H., Wang,Z.Y., Waxman,S. and Zelent,A. |
| Journal | EMBO J. 12 (3), 1161-1167 (1993) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |