• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens keratin 1 (KRT1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19449 Homo sapiens keratin 1 (KRT1), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu19449C Homo sapiens keratin 1 (KRT1), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_006121.3, 119395749
Length 1935 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens keratin 1 (KRT1), mRNA.
Product keratin, type II cytoskeletal 1
Comment

Summary: The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the spinous and granular layers of the epidermis with family member KRT10 and mutations in these genes have been associated with bullous congenital ichthyosiform erythroderma. The type II cytokeratins are clustered in a region of chromosome 12q12-q13. [provided by RefSeq, Jul 2008].

RefSeq NP_006112.3
CDS 60..1994
Misc Feature(1)51..53
Misc Feature(2)63..596
Misc Feature(3)63..596
Misc Feature(4)120..122
Misc Feature(5)120..122
Misc Feature(6)255..257
Misc Feature(7)303..305
Misc Feature(8)597..1535
Misc Feature(9)597..1526
Misc Feature(10)597..704
Misc Feature(11)705..761
Misc Feature(12)762..1037
Misc Feature(13)885..887
Misc Feature(14)<987..>1457
Misc Feature(15)1038..1109
Misc Feature(16)1089..1091
Misc Feature(17)1110..1526
Misc Feature(18)1356..1358
Misc Feature(19)1527..1991
Exon (1)1..650
Gene:KRT1
Gene Synonym:CK1; EHK; EHK1; EPPK; K1; KRT1A; NEPPK
Exon (2)651..865
Gene:KRT1
Gene Synonym:CK1; EHK; EHK1; EPPK; K1; KRT1A; NEPPK
Exon (3)866..926
Gene:KRT1
Gene Synonym:CK1; EHK; EHK1; EPPK; K1; KRT1A; NEPPK
Exon (4)927..1022
Gene:KRT1
Gene Synonym:CK1; EHK; EHK1; EPPK; K1; KRT1A; NEPPK
Exon (5)1023..1187
Gene:KRT1
Gene Synonym:CK1; EHK; EHK1; EPPK; K1; KRT1A; NEPPK
Exon (6)1188..1313
Gene:KRT1
Gene Synonym:CK1; EHK; EHK1; EPPK; K1; KRT1A; NEPPK
Exon (7)1314..1534
Gene:KRT1
Gene Synonym:CK1; EHK; EHK1; EPPK; K1; KRT1A; NEPPK
Exon (8)1535..1569
Gene:KRT1
Gene Synonym:CK1; EHK; EHK1; EPPK; K1; KRT1A; NEPPK
Exon (9)1570..2451
Gene:KRT1
Gene Synonym:CK1; EHK; EHK1; EPPK; K1; KRT1A; NEPPK
Translation MSRQFSSRSGYRSGGGFSSGSAGIINYQRRTTSSSTRRSGGGGGRFSSCGGGGGSFGAGG GFGSRSLVNLGGSKSISISVARGGGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFG GFGSGGGGFGGGGFGGGGYGGGYGPVCPPGGIQEVTINQSLLQPLNVEIDPEIQKVKSRE REQIKSLNNQFASFIDKVRFLEQQNQVLQTKWELLQQVDTSTRTHNLEPYFESFINNLRR RVDQLKSDQSRLDSELKNMQDMVEDYRNKYEDEINKRTNAENEFVTIKKDVDGAYMTKVD LQAKLDNLQQEIDFLTALYQAELSQMQTQISETNVILSMDNNRSLDLDSIIAEVKAQYED IAQKSKAEAESLYQSKYEELQITAGRHGDSVRNSKIEISELNRVIQRLRSEIDNVKKQIS NLQQSISDAEQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEIA TYRTLLEGEESRMSGECAPNVSVSVSTSHTTISGGGSRGGGGGGYGSGGSSYGSGGGSYG SGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSG GRGSGGGSSGGSIGGRGSSSGGVKSSGGSSSVKFVSTTYSGVTR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(31)-dbSNP:
complement(31)-t, cdbSNP:181130130
complement(39)-g, adbSNP:189087382
complement(69)-g, cdbSNP:201712128
complement(95)-t, cdbSNP:111907110
complement(118)-t, cdbSNP:368821072
complement(122)-t, adbSNP:142164771
complement(134)-g, adbSNP:828367
complement(137)-g, adbSNP:184313837
complement(141)-t, gdbSNP:146155769
complement(144)-g, adbSNP:201494492
complement(172)-t, cdbSNP:34787940
complement(191)-g, cdbSNP:192498048
complement(211)-t, cdbSNP:137920159
complement(252)-g, adbSNP:116444444
280+a, tdbSNP:57977969
complement(291)-t, cdbSNP:149480015
complement(313)-t, cdbSNP:138041295
complement(315)-t, gdbSNP:145256530
338+c, tdbSNP:2741151
340+a, tdbSNP:2741152
complement(341)-g, adbSNP:376901079
complement(361)-g, cdbSNP:147840212
complement(373)-c, adbSNP:146169155
complement(442..443)-, cdbSNP:145463787
458+c, tdbSNP:1050870
complement(492)-g, adbSNP:190219749
complement(511)-t, cdbSNP:376128876
523+a, g, tdbSNP:57959072
541+c, tdbSNP:57695159
complement(551)-g, adbSNP:142821486
complement(556)-t, cdbSNP:148526002
561..572+, gagattgaccctdbSNP:267607423
567..578+, gaccctgagatcdbSNP:267607426
complement(589)-t, cdbSNP:146820668
590+g, tdbSNP:58381018
595+c, gdbSNP:59044845
615+c, tdbSNP:60022878
618+c, tdbSNP:59151464
622+a, c, gdbSNP:58928370
623+a, cdbSNP:59429455
630+a, tdbSNP:59022806
631+g, tdbSNP:58008716
632+g, tdbSNP:59208902
636+c, tdbSNP:60937700
complement(647)-g, adbSNP:370368914
682+dbSNP:
682+c, tdbSNP:61616632
700+c, tdbSNP:61549035
complement(710)-g, cdbSNP:201584652
complement(712)-g, adbSNP:376472255
complement(713)-t, cdbSNP:143756169
752+g, tdbSNP:267607429
757+c, tdbSNP:60297570
779+a, gdbSNP:1050871
complement(788)-g, adbSNP:201069649
complement(800)-g, adbSNP:56895471
816+g, tdbSNP:193921116
complement(820)-g, adbSNP:372121916
821+a, gdbSNP:2741155
complement(832)-t, adbSNP:75711771
complement(837)-t, gdbSNP:149638013
complement(858)-g, adbSNP:369367702
859+a, gdbSNP:60359468
complement(940)-dbSNP:
complement(940)-g, adbSNP:377333980
complement(949)-t, gdbSNP:199852766
complement(956)-t, cdbSNP:144631643
complement(980)-t, gdbSNP:202173344
complement(983)-t, cdbSNP:200891005
complement(985)-t, adbSNP:374523527
990+c, gdbSNP:137853224
complement(1015)-t, cdbSNP:371171252
complement(1041)-dbSNP:
complement(1041)-t, adbSNP:139428176
complement(1045)-t, cdbSNP:369049651
1078+a, g, tdbSNP:58062863
complement(1094)-g, adbSNP:192365492
1131+a, tdbSNP:1050872
complement(1133)-t, g, adbSNP:150503977
complement(1137)-t, cdbSNP:267603525
complement(1147)-t, cdbSNP:374690429
complement(1158)-t, cdbSNP:371260991
complement(1166)-g, adbSNP:183980482
complement(1190)-dbSNP:
complement(1190)-g, adbSNP:370545890
complement(1196)-t, cdbSNP:141641507
complement(1212)-t, cdbSNP:267603524
complement(1295)-g, adbSNP:137978741
complement(1343)-dbSNP:
complement(1343)-c, adbSNP:117108628
complement(1352)-g, cdbSNP:369800756
complement(1353)-g, adbSNP:142781300
complement(1354)-t, cdbSNP:373780324
1369+c, tdbSNP:267607428
complement(1375)-t, cdbSNP:370833984
complement(1408)-g, cdbSNP:199877663
complement(1419)-c, adbSNP:17678945
complement(1428)-c, adbSNP:377282465
1435..1458+, cccgcctgctgcgcgactaccaggdbSNP:60447237
complement(1447)-t, cdbSNP:200254456
complement(1448)-g, adbSNP:936958
complement(1449)-t, cdbSNP:372937607
complement(1472)-t, gdbSNP:698170
1483+c, tdbSNP:137853225
1491+a, c, gdbSNP:59089201
1493+g, tdbSNP:58949162
1494+a, tdbSNP:61218439
1495+c, tdbSNP:57837128
1500+a, cdbSNP:59431558
1504+a, gdbSNP:58420087
1513+c, tdbSNP:267607430
1516+c, g, tdbSNP:56914602
1524+a, gdbSNP:58773503
1527+a, c, gdbSNP:60279707
1528+a, gdbSNP:58453920
complement(1541)-dbSNP:
complement(1541)-g, adbSNP:181516749
complement(1556)-t, cdbSNP:145112157
complement(1565)-g, adbSNP:34154891
complement(1568)-t, cdbSNP:140449947
complement(1579)-dbSNP:
complement(1579)-t, gdbSNP:75007002
complement(1586)-g, adbSNP:371428130
complement(1597)-g, cdbSNP:201825026
1615+, gdbSNP:58373389
1629..1655+, ggctacggctctggaggtagcagctatdbSNP:58193503
complement(1650)-t, cdbSNP:371732143
1668..1669+a, ggdbSNP:59169454
1687+, gdbSNP:57650413
1709+c, tdbSNP:11556631
1716..1736+, ggctccggaggtagcagctacdbSNP:267607656
complement(1725)-t, cdbSNP:371843007
complement(1728)-t, cdbSNP:77846840
complement(1736)-g, adbSNP:11170232
complement(1746)-t, cdbSNP:370799361
complement(1752)-t, cdbSNP:199947827
1810..1811+, gdbSNP:267607425
1821+a, gdbSNP:60526003
complement(1922)-t, cdbSNP:267603523
complement(1935)-t, adbSNP:200190157
1957+a, gdbSNP:14024
complement(1969)-g, adbSNP:376915013
complement(1971)-t, cdbSNP:140098565
2034+g, tdbSNP:2741161
complement(2080)-t, cdbSNP:190720388
complement(2089)-t, cdbSNP:144520865
complement(2111)-g, adbSNP:185664060
2195+c, tdbSNP:1050886
complement(2205)-g, adbSNP:370272283
complement(2215)-g, adbSNP:112275575
complement(2224)-, adbSNP:35022771
2274+a, tdbSNP:1050890
2337+a, tdbSNP:1050893
complement(2338)-g, adbSNP:11170231
2339+a, tdbSNP:1050895
2397+a, tdbSNP:1050897
Gene SymbolKRT1
Gene SynonymCK1; EHK; EHK1; EPPK; K1; KRT1A; NEPPK
Chromosome12
Locus Map12q13.13
Title Mild phenotype of epidermolytic hyperkeratosis mimicking ichthyosis bullosa of Siemens is related to specific mutation in 2B domain of KRT1 .
Author Sung,J.Y., Oh,S.W., Kim,S.E. and Kim,S.C.
Journal J. Dermatol. Sci. 70 (3), 220-222 (2013)
Title Epidemiology and clinical characteristics of bullous congenital ichthyosiform erythroderma (keratinolytic ichthyosis) in Japan: results from a nationwide survey .
Author Kurosawa M, Takagi A, Tamakoshi A, Kawamura T, Inaba Y, Yokoyama K, Kitajima Y, Aoyama Y, Iwatsuki K and Ikeda S.
Journal J. Am. Acad. Dermatol. 68 (2), 278-283 (2013)
Title A severe familial phenotype of Ichthyosis Curth-Macklin caused by a novel mutation in the KRT1 gene .
Author Fonseca,D.J., Rojas,R.F., Vergara,J.I., Rios,X., Uribe,C., Chavez,L., Velandia,F., Vargas,C.I., Restrepo,C.M. and Laissue,P.
Journal Br. J. Dermatol. 168 (2), 456-458 (2013)
Title Keratin 1 maintains skin integrity and participates in an inflammatory network in skin through interleukin-18 .
Author Roth W, Kumar V, Beer HD, Richter M, Wohlenberg C, Reuter U, Thiering S, Staratschek-Jox A, Hofmann A, Kreusch F, Schultze JL, Vogl T, Roth J, Reichelt J, Hausser I and Magin TM.
Journal J. Cell. Sci. 125 (PT 22), 5269-5279 (2012)
Title Identification Keratin 1 as a cDDP-resistant protein in nasopharyngeal carcinoma cell lines .
Author Tang S, Huang W, Zhong M, Yin L, Jiang H, Hou S, Gan P and Yuan Y.
Journal J Proteomics 75 (8), 2352-2360 (2012)
Title The two size alleles of human keratin 1 are due to a deletion in the glycine-rich carboxyl-terminal V2 subdomain .
Author Korge BP, Compton JG, Steinert PM and Mischke D.
Journal J. Invest. Dermatol. 99 (6), 697-702 (1992)
Title Linkage of epidermolytic hyperkeratosis to the type II keratin gene cluster on chromosome 12q .
Author Compton JG, DiGiovanna JJ, Santucci SK, Kearns KS, Amos CI, Abangan DL, Korge BP, McBride OW, Steinert PM and Bale SJ.
Journal Nat. Genet. 1 (4), 301-305 (1992)
Title Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin .
Author Dawson SJ and White LA.
Journal J. Infect. 24 (3), 317-320 (1992)
Title Chromosomal mapping of human keratin genes: evidence of non-linkage .
Author Lessin SR, Huebner K, Isobe M, Croce CM and Steinert PM.
Journal J. Invest. Dermatol. 91 (6), 572-578 (1988)
Title Role of transforming growth factor beta in the maturation of human epidermal keratinocytes .
Author Mansbridge JN and Hanawalt PC.
Journal J. Invest. Dermatol. 90 (3), 336-341 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.