• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens keratin 1 (KRT1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_006121 Homo sapiens keratin 1 (KRT1), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_006121.3, 119395749
Length 2451 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens keratin 1 (KRT1), mRNA.
Product keratin, type II cytoskeletal 1
Comment

Summary: The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the spinous and granular layers of the epidermis with family member KRT10 and mutations in these genes have been associated with bullous congenital ichthyosiform erythroderma. The type II cytokeratins are clustered in a region of chromosome 12q12-q13. [provided by RefSeq, Jul 2008].

RefSeq NP_006112.3
CDS 60..1994
Misc Feature(1)51..53
Misc Feature(2)63..596
Misc Feature(3)63..596
Misc Feature(4)120..122
Misc Feature(5)120..122
Misc Feature(6)255..257
Misc Feature(7)303..305
Misc Feature(8)597..1535
Misc Feature(9)597..1526
Misc Feature(10)597..704
Misc Feature(11)705..761
Misc Feature(12)762..1037
Misc Feature(13)885..887
Misc Feature(14)1038..1109
Misc Feature(15)1089..1091
Misc Feature(16)1110..1526
Misc Feature(17)1272..>1454
Misc Feature(18)1356..1358
Misc Feature(19)1527..1991
Exon (1)1..650
Gene:KRT1
Gene Synonym:CK1; EHK; EHK1; EPPK; K1; KRT1A; NEPPK
Exon (2)651..865
Gene:KRT1
Gene Synonym:CK1; EHK; EHK1; EPPK; K1; KRT1A; NEPPK
Exon (3)866..926
Gene:KRT1
Gene Synonym:CK1; EHK; EHK1; EPPK; K1; KRT1A; NEPPK
Exon (4)927..1022
Gene:KRT1
Gene Synonym:CK1; EHK; EHK1; EPPK; K1; KRT1A; NEPPK
Exon (5)1023..1187
Gene:KRT1
Gene Synonym:CK1; EHK; EHK1; EPPK; K1; KRT1A; NEPPK
Exon (6)1188..1313
Gene:KRT1
Gene Synonym:CK1; EHK; EHK1; EPPK; K1; KRT1A; NEPPK
Exon (7)1314..1534
Gene:KRT1
Gene Synonym:CK1; EHK; EHK1; EPPK; K1; KRT1A; NEPPK
Exon (8)1535..1569
Gene:KRT1
Gene Synonym:CK1; EHK; EHK1; EPPK; K1; KRT1A; NEPPK
Exon (9)1570..2451
Gene:KRT1
Gene Synonym:CK1; EHK; EHK1; EPPK; K1; KRT1A; NEPPK
Translation MSRQFSSRSGYRSGGGFSSGSAGIINYQRRTTSSSTRRSGGGGGRFSSCGGGGGSFGAGG GFGSRSLVNLGGSKSISISVARGGGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFG GFGSGGGGFGGGGFGGGGYGGGYGPVCPPGGIQEVTINQSLLQPLNVEIDPEIQKVKSRE REQIKSLNNQFASFIDKVRFLEQQNQVLQTKWELLQQVDTSTRTHNLEPYFESFINNLRR RVDQLKSDQSRLDSELKNMQDMVEDYRNKYEDEINKRTNAENEFVTIKKDVDGAYMTKVD LQAKLDNLQQEIDFLTALYQAELSQMQTQISETNVILSMDNNRSLDLDSIIAEVKAQYED IAQKSKAEAESLYQSKYEELQITAGRHGDSVRNSKIEISELNRVIQRLRSEIDNVKKQIS NLQQSISDAEQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEIA TYRTLLEGEESRMSGECAPNVSVSVSTSHTTISGGGSRGGGGGGYGSGGSSYGSGGGSYG SGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSG GRGSGGGSSGGSIGGRGSSSGGVKSSGGSSSVKFVSTTYSGVTR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(31)-dbSNP:
complement(31)-t, cdbSNP:181130130
complement(39)-g, adbSNP:189087382
complement(69)-g, cdbSNP:201712128
complement(95)-t, cdbSNP:111907110
complement(98)-g, adbSNP:146356831
complement(122)-t, adbSNP:142164771
complement(134)-g, adbSNP:828367
complement(137)-g, adbSNP:184313837
complement(141)-t, gdbSNP:146155769
complement(144)-g, adbSNP:201494492
complement(172)-t, cdbSNP:34787940
complement(184)-c, adbSNP:148192725
complement(191)-g, cdbSNP:192498048
complement(211)-t, cdbSNP:137920159
complement(252)-g, adbSNP:116444444
complement(280)-t, adbSNP:57977969
complement(291)-t, cdbSNP:149480015
complement(313)-t, cdbSNP:138041295
complement(315)-t, gdbSNP:145256530
complement(330)-g, cdbSNP:141350025
complement(338)-t, cdbSNP:2741151
complement(340)-t, adbSNP:2741152
complement(361)-g, cdbSNP:147840212
complement(373)-c, adbSNP:146169155
complement(407)-t, adbSNP:140909071
complement(442..443)-, cdbSNP:145463787
complement(452)-t, adbSNP:151034754
complement(458)-t, cdbSNP:1050870
complement(492)-g, adbSNP:190219749
complement(523)-t, g, adbSNP:57959072
complement(541)-t, cdbSNP:57695159
complement(551)-g, adbSNP:142821486
complement(556)-t, cdbSNP:148526002
complement(561..572)-, gagattgaccctdbSNP:267607423
complement(567..578)-, gaccctgagatcdbSNP:267607426
complement(589)-t, cdbSNP:146820668
complement(590)-t, gdbSNP:58381018
complement(595)-g, cdbSNP:59044845
complement(615)-t, cdbSNP:60022878
complement(618)-t, cdbSNP:59151464
complement(622)-g, c, adbSNP:58928370
complement(623)-c, adbSNP:59429455
complement(630)-t, adbSNP:59022806
complement(631)-t, gdbSNP:58008716
complement(632)-t, gdbSNP:59208902
complement(636)-t, cdbSNP:60937700
complement(682)-dbSNP:
complement(682)-t, cdbSNP:61616632
complement(700)-t, cdbSNP:61549035
complement(710)-g, cdbSNP:201584652
complement(713)-t, cdbSNP:143756169
complement(752)-t, gdbSNP:267607429
complement(757)-t, cdbSNP:60297570
complement(779)-g, adbSNP:1050871
complement(788)-g, adbSNP:201069649
complement(800)-g, adbSNP:56895471
complement(816)-t, gdbSNP:193921116
complement(821)-g, adbSNP:2741155
complement(832)-t, adbSNP:75711771
complement(837)-t, gdbSNP:149638013
complement(859)-g, adbSNP:60359468
complement(949)-dbSNP:
complement(949)-t, gdbSNP:199852766
complement(956)-t, cdbSNP:144631643
complement(980)-t, gdbSNP:202173344
complement(983)-t, cdbSNP:200891005
complement(990)-g, cdbSNP:137853224
complement(1041)-dbSNP:
complement(1041)-t, adbSNP:139428176
complement(1078)-t, g, adbSNP:58062863
complement(1094)-g, adbSNP:192365492
complement(1131)-t, adbSNP:1050872
complement(1133)-t, g, adbSNP:150503977
complement(1166)-g, adbSNP:183980482
complement(1196)-dbSNP:
complement(1196)-t, cdbSNP:141641507
complement(1295)-g, adbSNP:137978741
complement(1296)-t, cdbSNP:146960070
complement(1343)-dbSNP:
complement(1343)-c, adbSNP:117108628
complement(1353)-g, adbSNP:142781300
complement(1369)-t, cdbSNP:267607428
complement(1408)-g, cdbSNP:199877663
complement(1419)-c, adbSNP:17678945
complement(1435..1458)-, cccgcctgctgcgcgactaccaggdbSNP:60447237
complement(1447)-t, cdbSNP:200254456
complement(1448)-g, adbSNP:936958
complement(1472)-t, gdbSNP:698170
complement(1483)-t, cdbSNP:137853225
complement(1491)-g, c, adbSNP:59089201
complement(1493)-t, gdbSNP:58949162
complement(1494)-t, adbSNP:61218439
complement(1495)-t, cdbSNP:57837128
complement(1500)-c, adbSNP:59431558
complement(1504)-g, adbSNP:58420087
complement(1513)-t, cdbSNP:267607430
complement(1516)-t, g, cdbSNP:56914602
complement(1524)-g, adbSNP:58773503
complement(1527)-g, c, adbSNP:60279707
complement(1528)-g, adbSNP:58453920
complement(1541)-dbSNP:
complement(1541)-g, adbSNP:181516749
complement(1556)-t, cdbSNP:145112157
complement(1565)-g, adbSNP:34154891
complement(1568)-t, cdbSNP:140449947
complement(1579)-dbSNP:
complement(1579)-t, gdbSNP:75007002
complement(1597)-g, cdbSNP:201825026
complement(1615)-, gdbSNP:58373389
complement(1629..1655)-, ggctacggctctggaggtagcagctatdbSNP:58193503
complement(1633)-t, gdbSNP:146802781
complement(1668..1669)-gg, adbSNP:59169454
complement(1687)-, gdbSNP:57650413
complement(1708..1728)-, tacctccggagccatagctgcdbSNP:66529359
complement(1709)-t, cdbSNP:11556631
1716..1736+, ggctccggaggtagcagctacdbSNP:267607656
complement(1728)-t, cdbSNP:77846840
complement(1736)-g, adbSNP:11170232
complement(1752..1772)-, gccacctccagagccatagctdbSNP:67486529
complement(1752)-t, cdbSNP:199947827
complement(1810..1811)-, gdbSNP:267607425
complement(1821)-g, adbSNP:60526003
complement(1935)-t, adbSNP:200190157
complement(1957)-g, adbSNP:14024
complement(1971)-t, cdbSNP:140098565
complement(2034)-t, gdbSNP:2741161
complement(2080)-t, cdbSNP:190720388
complement(2089)-t, cdbSNP:144520865
complement(2111)-g, adbSNP:185664060
complement(2195)-t, cdbSNP:1050886
complement(2215)-g, adbSNP:112275575
complement(2224)-, adbSNP:35022771
complement(2274)-t, adbSNP:1050890
complement(2337)-t, adbSNP:1050893
complement(2338)-g, adbSNP:11170231
complement(2339)-t, adbSNP:1050895
complement(2397)-t, adbSNP:1050897
Gene SymbolKRT1
Gene SynonymCK1; EHK; EHK1; EPPK; K1; KRT1A; NEPPK
Chromosome12
Locus Map12q13.13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006121 Homo sapiens keratin 1 (KRT1), mRNA. On-demand TBD TBD
Title Epidemiology and clinical characteristics of bullous congenital ichthyosiform erythroderma (keratinolytic ichthyosis) in Japan: results from a nationwide survey .
Author Kurosawa,M., Takagi,A., Tamakoshi,A., Kawamura,T., Inaba,Y., Yokoyama,K., Kitajima,Y., Aoyama,Y., Iwatsuki,K. and Ikeda,S.
Journal J. Am. Acad. Dermatol. 68 (2), 278-283 (2013)
Title Identification Keratin 1 as a cDDP-resistant protein in nasopharyngeal carcinoma cell lines .
Author Tang,S., Huang,W., Zhong,M., Yin,L., Jiang,H., Hou,S., Gan,P. and Yuan,Y.
Journal J Proteomics 75 (8), 2352-2360 (2012)
Title Increase of alpha-SMA(+) and CK (+) cells as an early sign of epithelial-mesenchymal transition during colorectal carcinogenesis .
Author Valcz,G., Sipos,F., Krenacs,T., Molnar,J., Patai,A.V., Leiszter,K., Toth,K., Wichmann,B., Molnar,B. and Tulassay,Z.
Journal Pathol. Oncol. Res. 18 (2), 371-376 (2012)
Title A recurrent missense mutation of keratin 1 gene in a Chinese family with epidermolytic hyperkeratosis (severe palmoplantar hyperkeratosis, type 1) .
Author Zeng,Y.P., Chai,W.X., Fang,K., Sun,Q.N. and Zuo,Y.G.
Journal Int. J. Dermatol. 51 (2), 182-185 (2012)
Title Expanding the keratin mutation database: novel and recurrent mutations and genotype-phenotype correlations in 28 patients with epidermolytic ichthyosis .
Author Arin,M.J., Oji,V., Emmert,S., Hausser,I., Traupe,H., Krieg,T. and Grimberg,G.
Journal Br. J. Dermatol. 164 (2), 442-447 (2011)
Title The two size alleles of human keratin 1 are due to a deletion in the glycine-rich carboxyl-terminal V2 subdomain .
Author Korge,B.P., Compton,J.G., Steinert,P.M. and Mischke,D.
Journal J. Invest. Dermatol. 99 (6), 697-702 (1992)
Title Linkage of epidermolytic hyperkeratosis to the type II keratin gene cluster on chromosome 12q .
Author Compton,J.G., DiGiovanna,J.J., Santucci,S.K., Kearns,K.S., Amos,C.I., Abangan,D.L., Korge,B.P., McBride,O.W., Steinert,P.M. and Bale,S.J.
Journal Nat. Genet. 1 (4), 301-305 (1992)
Title Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin .
Author Dawson,S.J. and White,L.A.
Journal J. Infect. 24 (3), 317-320 (1992)
Title Chromosomal mapping of human keratin genes: evidence of non-linkage .
Author Lessin,S.R., Huebner,K., Isobe,M., Croce,C.M. and Steinert,P.M.
Journal J. Invest. Dermatol. 91 (6), 572-578 (1988)
Title Role of transforming growth factor beta in the maturation of human epidermal keratinocytes .
Author Mansbridge,J.N. and Hanawalt,P.C.
Journal J. Invest. Dermatol. 90 (3), 336-341 (1988)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.