• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens neurotrophin 4 (NTF4), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_006179 Homo sapiens neurotrophin 4 (NTF4), mRNA. GenEZ ORF Cloning On-demand $399.00 14

*Business Day

Related Services

RefSeq Version NM_006179.4, 169658373
Length 999 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens neurotrophin 4 (NTF4), mRNA.
Product neurotrophin-4 preproprotein
Comment

Summary: This gene is a member of a family of neurotrophic factors, neurotrophins, that control survival and differentiation of mammalian neurons. The expression of this gene is ubiquitous and less influenced by environmental signals. While knock-outs of other neurotrophins including nerve growth factor, brain-derived neurotrophic factor, and neurotrophin 3 prove lethal during early postnatal development, NTF5-deficient mice only show minor cellular deficits and develop normally to adulthood. [provided by RefSeq, Jul 2008].


Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.

RefSeq NP_006170.1
CDS 142..774
Misc Feature(1)124..126
Misc Feature(2)124..126
Misc Feature(3)397..768
Exon (1)1..129
Gene:NTF4
Gene Synonym:GLC10; GLC1O; NT-4; NT-4/5; NT-5; NT4; NT5; NTF5
Exon (2)130..999
Gene:NTF4
Gene Synonym:GLC10; GLC1O; NT-4; NT-4/5; NT-5; NT4; NT5; NTF5
Translation MLPLPSCSLPILLLFLLPSVPIESQPPPSTLPPFLAPEWDLLSPRVVLSRGAPAGPPLLF LLEAGAFRESAGAPANRSRRGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEV LGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRAL TADAQGRVGWRWIRIDTACVCTLLSRTGRA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(169)-t, gdbSNP:201071858
complement(344)-t, cdbSNP:200786116
complement(364)-t, cdbSNP:186082918
complement(384)-t, cdbSNP:145884553
complement(404)-t, cdbSNP:61732310
complement(435)-g, adbSNP:199958178
complement(452)-c, adbSNP:202216349
complement(502)-g, adbSNP:149008630
complement(521)-g, adbSNP:145846156
complement(538)-g, adbSNP:144842220
complement(558)-t, gdbSNP:62127897
complement(559..560)-, tdbSNP:34922845
complement(559)-g, adbSNP:201069064
complement(577)-c, adbSNP:140946623
complement(640)-g, cdbSNP:200878406
complement(693)-g, cdbSNP:147294437
complement(700)-g, adbSNP:144346396
complement(702)-g, adbSNP:142027939
complement(739)-t, cdbSNP:200081067
complement(757)-t, cdbSNP:121918427
complement(758)-g, adbSNP:121918428
complement(766)-g, cdbSNP:200675509
complement(800)-t, cdbSNP:116348522
complement(833)-g, adbSNP:151306084
complement(884)-t, cdbSNP:115969617
complement(966)-g, cdbSNP:112004444
Gene SymbolNTF4
Gene SynonymGLC10; GLC1O; NT-4; NT-4/5; NT-5; NT4; NT5; NTF5
Chromosome19
Locus Map19q13.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006179 Homo sapiens neurotrophin 4 (NTF4), mRNA. On-demand $399.00 14
Title The inorganic perspectives of neurotrophins and Alzheimer's disease .
Author Travaglia,A., Pietropaolo,A., La Mendola,D., Nicoletti,V.G. and Rizzarelli,E.
Journal J. Inorg. Biochem. 111, 130-137 (2012)
Title Evaluation of NTF4 as a causative gene for primary open-angle glaucoma .
Author Chen,L.J., Ng,T.K., Fan,A.H., Leung,D.Y., Zhang,M., Wang,N., Zheng,Y., Liang,X.Y., Chiang,S.W., Tam,P.O. and Pang,C.P.
Journal Mol. Vis. 18, 1763-1772 (2012)
Title Immune cell NT-3 expression is associated with brain atrophy in multiple sclerosis patients .
Author Kalinowska-Lyszczarz,A., Pawlak,M.A., Michalak,S., Paprzycki,W. and Losy,J.
Journal J. Neuroimmunol. 240-241, 109-113 (2011)
Title Neurotrophic tyrosine kinase receptor B/neurotrophin 4 signaling axis is perturbed in clinical and experimental pulmonary fibrosis .
Author Avcuoglu,S., Wygrecka,M., Marsh,L.M., Gunther,A., Seeger,W., Weissmann,N., Fink,L., Morty,R.E. and Kwapiszewska,G.
Journal Am. J. Respir. Cell Mol. Biol. 45 (4), 768-780 (2011)
Title Brain-derived neurotrophic factor and neurotrophin-4/5 are expressed in breast cancer and can be targeted to inhibit tumor cell survival .
Author Vanhecke,E., Adriaenssens,E., Verbeke,S., Meignan,S., Germain,E., Berteaux,N., Nurcombe,V., Le Bourhis,X. and Hondermarck,H.
Journal Clin. Cancer Res. 17 (7), 1741-1752 (2011)
Title Differential role of the low affinity neurotrophin receptor (p75) in retrograde axonal transport of the neurotrophins .
Author Curtis,R., Adryan,K.M., Stark,J.L., Park,J.S., Compton,D.L., Weskamp,G., Huber,L.J., Chao,M.V., Jaenisch,R., Lee,K.F. et al.
Journal Neuron 14 (6), 1201-1211 (1995)
Title Human chromosome 19 contains the neurotrophin-5 gene locus and three related genes that may encode novel acidic neurotrophins .
Author Berkemeier,L.R., Ozcelik,T., Francke,U. and Rosenthal,A.
Journal Somat. Cell Mol. Genet. 18 (3), 233-245 (1992)
Title Mammalian neurotrophin-4: structure, chromosomal localization, tissue distribution, and receptor specificity .
Author Ip,N.Y., Ibanez,C.F., Nye,S.H., McClain,J., Jones,P.F., Gies,D.R., Belluscio,L., Le Beau,M.M., Espinosa,R. III, Squinto,S.P. et al.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (7), 3060-3064 (1992)
Title Neurotrophin-5: a novel neurotrophic factor that activates trk and trkB .
Author Berkemeier,L.R., Winslow,J.W., Kaplan,D.R., Nikolics,K., Goeddel,D.V. and Rosenthal,A.
Journal Neuron 7 (5), 857-866 (1991)
Title Dissociation equilibrium constant of beta nerve growth factor .
Author Bothwell,M.A. and Shooter,E.M.
Journal J. Biol. Chem. 252 (23), 8532-8536 (1977)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.