• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens nuclear mitotic apparatus protein 1 (NUMA1), mRNA.


RefSeq Accession Definition Services Price Order
NM_006185 Homo sapiens nuclear mitotic apparatus protein 1 (NUMA1), mRNA. ORF Sequence $2856.60
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_006185.2, 71361681
Length 7182 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens nuclear mitotic apparatus protein 1 (NUMA1), mRNA.
Product nuclear mitotic apparatus protein 1
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BG771637.1, BC027493.1, AB210007.1 and AP002490.4. On Jul 28, 2005 this sequence version replaced gi:5453819.

RefSeq NP_006176.2
CDS 173..6520
Misc Feature(1)152..154
Misc Feature(2)152..154
Misc Feature(3)173..808
Misc Feature(4)173..808
Misc Feature(5)677..679
Misc Feature(6)677..679
Misc Feature(7)686..688
Misc Feature(8)770..772
Misc Feature(9)779..781
Misc Feature(10)779..781
Misc Feature(11)<797..>1651
Misc Feature(12)803..805
Misc Feature(13)803..805
Misc Feature(14)983..985
Misc Feature(15)1037..1039
Misc Feature(16)1307..1309
Misc Feature(17)1334..1336
Misc Feature(18)1334..1336
Misc Feature(19)1355..1357
Misc Feature(20)1355..1357
Misc Feature(21)1403..1405
Misc Feature(22)<2222..>2983
Misc Feature(23)2630..2632
Misc Feature(24)2630..2632
Misc Feature(25)2843..2845
Misc Feature(26)3059..3061
Misc Feature(27)3731..3733
Misc Feature(28)3845..3847
Misc Feature(29)3956..3958
Misc Feature(30)<4082..>4849
Misc Feature(31)4703..4705
Misc Feature(32)4973..4975
Misc Feature(33)4973..4975
Misc Feature(34)5270..6517
Misc Feature(35)5333..5335
Misc Feature(36)5333..5335
Misc Feature(37)5342..5344
Misc Feature(38)5342..5344
Misc Feature(39)5354..5356
Misc Feature(40)5354..5356
Misc Feature(41)5369..5371
Misc Feature(42)5408..>5869
Misc Feature(43)5441..5443
Misc Feature(44)5441..5443
Misc Feature(45)5441..5443
Misc Feature(46)5450..5452
Misc Feature(47)5450..5452
Misc Feature(48)5477..5479
Misc Feature(49)5477..5479
Misc Feature(50)5486..5488
Misc Feature(51)5486..5488
Misc Feature(52)5492..5494
Misc Feature(53)5492..5494
Misc Feature(54)5498..5500
Misc Feature(55)5498..5500
Misc Feature(56)5534..5536
Misc Feature(57)5537..5539
Misc Feature(58)5546..5548
Misc Feature(59)5570..5572
Misc Feature(60)5582..5584
Misc Feature(61)5660..5662
Misc Feature(62)5660..5662
Misc Feature(63)5669..5671
Misc Feature(64)5669..5671
Misc Feature(65)5672..5674
Misc Feature(66)5672..5674
Misc Feature(67)5678..5680
Misc Feature(68)5681..5683
Misc Feature(69)5690..5692
Misc Feature(70)5729..5731
Misc Feature(71)5756..5758
Misc Feature(72)5756..5758
Misc Feature(73)5765..5767
Misc Feature(74)5768..5980
Misc Feature(75)5774..5776
Misc Feature(76)5786..5788
Misc Feature(77)5831..5833
Misc Feature(78)6005..6007
Misc Feature(79)6077..6079
Misc Feature(80)6122..6139
Misc Feature(81)6143..6145
Misc Feature(82)6170..6172
Misc Feature(83)6170..6172
Misc Feature(84)6170..6172
Misc Feature(85)6179..6181
Misc Feature(86)6179..6181
Misc Feature(87)6215..6217
Misc Feature(88)6335..6337
Misc Feature(89)6401..6403
Misc Feature(90)6431..6433
Misc Feature(91)6488..6490
Exon (1)1..70
Gene:NUMA1
Gene Synonym:NUMA
Exon (2)71..140
Gene:NUMA1
Gene Synonym:NUMA
Exon (3)141..214
Gene:NUMA1
Gene Synonym:NUMA
Exon (4)215..300
Gene:NUMA1
Gene Synonym:NUMA
Exon (5)301..380
Gene:NUMA1
Gene Synonym:NUMA
Exon (6)381..463
Gene:NUMA1
Gene Synonym:NUMA
Exon (7)464..544
Gene:NUMA1
Gene Synonym:NUMA
Exon (8)545..632
Gene:NUMA1
Gene Synonym:NUMA
Exon (9)633..756
Gene:NUMA1
Gene Synonym:NUMA
Exon (10)757..914
Gene:NUMA1
Gene Synonym:NUMA
Exon (11)915..1032
Gene:NUMA1
Gene Synonym:NUMA
Exon (12)1033..1150
Gene:NUMA1
Gene Synonym:NUMA
Exon (13)1151..1291
Gene:NUMA1
Gene Synonym:NUMA
Exon (14)1292..1414
Gene:NUMA1
Gene Synonym:NUMA
Exon (15)1415..4780
Gene:NUMA1
Gene Synonym:NUMA
Exon (16)4781..4822
Gene:NUMA1
Gene Synonym:NUMA
Exon (17)4823..4891
Gene:NUMA1
Gene Synonym:NUMA
Exon (18)4892..5011
Gene:NUMA1
Gene Synonym:NUMA
Exon (19)5012..5230
Gene:NUMA1
Gene Synonym:NUMA
Exon (20)5231..5388
Gene:NUMA1
Gene Synonym:NUMA
Exon (21)5389..5635
Gene:NUMA1
Gene Synonym:NUMA
Exon (22)5636..5864
Gene:NUMA1
Gene Synonym:NUMA
Exon (23)5865..6001
Gene:NUMA1
Gene Synonym:NUMA
Exon (24)6002..6178
Gene:NUMA1
Gene Synonym:NUMA
Exon (25)6179..6295
Gene:NUMA1
Gene Synonym:NUMA
Exon (26)6296..6508
Gene:NUMA1
Gene Synonym:NUMA
Exon (27)6509..7182
Gene:NUMA1
Gene Synonym:NUMA
Translation MTLHATRGAALLSWVNSLHVADPVEAVLQLQDCSIFIKIIDRIHGTEEGQQILKQPVSER LDFVCSFLQKNRKHPSSPECLVSAQKVLEGSELELAKMTMLLLYHSTMSSKSPRDWEQFE YKIQAELAVILKFVLDHEDGLNLNEDLENFLQKAPVPSTCSSTFPEELSPPSHQAKREIR FLELQKVASSSSGNNFLSGSPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAEN RKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKELEELRDKNESLTMRLHETLKQCQ DLKTEKSQMDRKINQLSEENGDLSFKLREFASHLQQLQDALNELTEEHSKATQEWLEKQA QLEKELSAALQDKKCLEEKNEILQGKLSQLEEHLSQLQDNPPQEKGEVLGDVLQLETLKQ EAATLAANNTQLQARVEMLETERGQQEAKLLAERGHFEEEKQQLSSLITDLQSSISNLSQ AKEELEQASQAHGARLTAQVASLTSELTTLNATIQQQDQELAGLKQQAKEKQAQLAQTLQ QQEQASQGLRHQVEQLSSSLKQKEQQLKEVAEKQEATRQDHAQQLATAAEEREASLRERD AALKQLEALEKEKAAKLEILQQQLQVANEARDSAQTSVTQAQREKAELSRKVEELQACVE TARQEQHEAQAQVAELELQLRSEQQKATEKERVAQEKDQLQEQLQALKESLKVTKGSLEE EKRRAADALEEQQRCISELKAETRSLVEQHKRERKELEEERAGRKGLEARLQQLGEAHQA ETEVLRRELAEAMAAQHTAESECEQLVKEVAAWRERYEDSQQEEAQYGAMFQEQLMTLKE ECEKARQELQEAKEKVAGIESHSELQISRQQNELAELHANLARALQQVQEKEVRAQKLAD DLSTLQEKMAATSKEVARLETLVRKAGEQQETASRELVKEPARAGDRQPEWLEEQQGRQF CSTQAALQAMEREAEQMGNELERLRAALMESQGQQQEERGQQEREVARLTQERGRAQADL ALEKAARAELEMRLQNALNEQRVEFATLQEALAHALTEKEGKDQELAKLRGLEAAQIKEL EELRQTVKQLKEQLAKKEKEHASGSGAQSEAAGRTEPTGPKLEALRAEVSKLEQQCQKQQ EQADSLERSLEAERASRAERDSALETLQGQLEEKAQELGHSQSALASAQRELAAFRTKVQ DHSKAEDEWKAQVARGRQEAERKNSLISSLEEEVSILNRQVLEKEGESKELKRLVMAESE KSQKLEERLRLLQAETASNSARAAERSSALREEVQSLREEAEKQRVASENLRQELTSQAE RAEELGQELKAWQEKFFQKEQALSTLQLEHTSTQALVSELLPAKHLCQQLQAEQAAAEKR HREELEQSKQAAGGLRAELLRAQRELGELIPLRQKVAEQERTAQQLRAEKASYAEQLSML KKAHGLLAEENRGLGERANLGRQFLEVELDQAREKYVQELAAVRADAETRLAEVQREAQS TARELEVMTAKYEGAKVKVLEERQRFQEERQKLTAQVEQLEVFQREQTKQVEELSKKLAD SDQASKVQQQKLKAVQAQGGESQQEAQRLQAQLNELQAQLSQKEQAAEHYKLQMEKAKTH YDAKKQQNQELQEQLRSLEQLQKENKELRAEAERLGHELQQAGLKTKEAEQTCRHLTAQV RSLEAQVAHADQQLRDLGKFQVATDALKSREPQAKPQLDLSIDSLDLSCEEGTPLSITSK LPRTQPDGTSVPGEPASPISQRLPPKVESLESLYFTPIPARSQAPLESSLDSLGDVFLDS GRKTRSARRRTTQIINITMTKKLDVEEPDSANSSFYSTRSAPASQASLRATSSTQSLARL GSPDYGNSALLSLPGYRPTTRSSARRSQAGVSSGAPPGRNSFYMGTCQDEPEQLDDWNRI AELQQRNRVCPPHLKTCYPLESRPSLSLGTITDEEMKTGDPQETLRRASMQPIQIAEGTG ITTRQQRKRVSLEPHQGPGTPESKKATSCFPRPMTPRDRHEGRKQSTTEAQKKAAPASTK QADRRQSMAFSILNTPKKLGNSLLRRGASKKALSKASPNTRSGTRRSPRIATTTASAATA AAIGATPRAKGKAKH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(64)-dbSNP:
complement(64)-g, adbSNP:114912925
complement(171)-t, cdbSNP:149620306
complement(181)-g, cdbSNP:138259504
complement(186)-g, adbSNP:147122825
complement(191)-g, adbSNP:143306302
complement(192)-t, cdbSNP:201524124
complement(303)-dbSNP:
complement(303)-t, cdbSNP:199851967
complement(327)-t, adbSNP:137956915
complement(340)-t, cdbSNP:146932177
complement(386)-dbSNP:
complement(386)-g, cdbSNP:141726451
complement(393)-t, gdbSNP:140051813
complement(414)-t, adbSNP:201872246
complement(457)-t, cdbSNP:113315375
complement(459)-g, adbSNP:151173629
complement(469)-dbSNP:
complement(469)-g, adbSNP:143065802
complement(482)-g, adbSNP:200895025
complement(496)-t, cdbSNP:149868280
complement(532)-t, cdbSNP:146482232
complement(589)-dbSNP:
complement(589)-g, adbSNP:141785503
complement(590)-t, cdbSNP:140405205
complement(648)-dbSNP:
complement(648)-g, adbSNP:146743068
complement(664)-t, gdbSNP:149775256
complement(681)-g, adbSNP:199958172
complement(710)-g, adbSNP:139676280
complement(732)-g, adbSNP:150648243
complement(745)-g, adbSNP:201565115
complement(807)-dbSNP:
complement(807)-t, gdbSNP:78911887
complement(808)-t, gdbSNP:78805600
complement(824)-g, adbSNP:142862862
complement(897)-t, cdbSNP:34239655
complement(910)-c, adbSNP:139072829
complement(942)-dbSNP:
complement(942)-t, cdbSNP:190582413
complement(957)-g, adbSNP:147509804
complement(979)-t, cdbSNP:201045195
complement(1019)-t, cdbSNP:143164985
complement(1103)-dbSNP:
complement(1103)-g, adbSNP:139359161
complement(1114)-g, cdbSNP:147316914
complement(1153)-dbSNP:
complement(1153)-t, cdbSNP:143260427
complement(1155)-t, cdbSNP:139891320
complement(1172)-g, cdbSNP:200581089
complement(1202)-g, cdbSNP:117729282
complement(1205)-t, adbSNP:150123720
complement(1207)-t, cdbSNP:140773501
complement(1210)-t, cdbSNP:61749193
complement(1254)-t, cdbSNP:200776294
complement(1271)-t, cdbSNP:137910688
complement(1273)-g, adbSNP:201583885
complement(1312)-dbSNP:
complement(1312)-g, adbSNP:142927239
complement(1400)-t, cdbSNP:145461809
complement(1415)-dbSNP:
complement(1415)-g, cdbSNP:200242038
complement(1499)-g, cdbSNP:140321664
complement(1500)-t, cdbSNP:34335618
complement(1536)-t, c, adbSNP:34441100
complement(1561)-g, cdbSNP:142208518
complement(1568)-t, gdbSNP:200749852
complement(1579)-t, adbSNP:149147440
complement(1602)-t, cdbSNP:145185561
complement(1630)-t, cdbSNP:200361756
complement(1652)-t, cdbSNP:150021680
complement(1739)-t, cdbSNP:139983316
complement(1794)-t, cdbSNP:61756007
complement(1813)-g, cdbSNP:147473107
complement(1824)-t, cdbSNP:200470926
complement(1843)-g, adbSNP:201184219
complement(1888)-t, cdbSNP:144839807
complement(1936)-g, adbSNP:17161802
complement(1947)-t, cdbSNP:147334088
complement(1962)-c, adbSNP:142002151
complement(2012)-g, cdbSNP:148204936
complement(2066)-t, cdbSNP:143872566
complement(2070)-t, cdbSNP:201059127
complement(2099)-g, adbSNP:149446307
complement(2128)-t, cdbSNP:137943559
complement(2203)-g, cdbSNP:199958873
complement(2218)-g, adbSNP:145314839
complement(2272)-g, cdbSNP:141773601
complement(2335)-t, cdbSNP:200446758
complement(2342)-t, cdbSNP:138657430
complement(2394)-g, cdbSNP:185327928
complement(2402)-g, cdbSNP:201001720
complement(2410)-g, cdbSNP:150177622
complement(2452)-t, cdbSNP:140880451
complement(2487)-t, adbSNP:1053600
complement(2493)-c, adbSNP:201697611
complement(2509)-g, adbSNP:3750912
complement(2532)-t, cdbSNP:200110896
complement(2553)-g, cdbSNP:3750913
complement(2574)-t, cdbSNP:141508454
complement(2599)-t, adbSNP:143000254
complement(2656)-g, adbSNP:36029905
complement(2733)-t, gdbSNP:200650100
complement(2777)-g, adbSNP:140958526
complement(2789)-g, adbSNP:1053601
complement(2831)-g, cdbSNP:187108019
complement(2903)-c, adbSNP:201829820
complement(2924)-g, adbSNP:61756008
complement(2925)-t, cdbSNP:143299097
complement(2975)-g, adbSNP:183576691
complement(3030)-t, cdbSNP:201383824
complement(3086)-g, adbSNP:200653308
complement(3087)-t, cdbSNP:149184541
complement(3104)-t, cdbSNP:11235419
complement(3109)-g, adbSNP:142372284
complement(3126)-t, cdbSNP:139068712
complement(3130)-g, adbSNP:200722845
complement(3141)-t, cdbSNP:146223910
complement(3192)-g, adbSNP:141626208
complement(3215)-g, adbSNP:201363056
complement(3270)-t, cdbSNP:200911497
complement(3319)-t, cdbSNP:138719127
complement(3324)-g, adbSNP:150479005
complement(3325)-t, cdbSNP:202246796
complement(3335)-c, adbSNP:149499808
complement(3364)-t, cdbSNP:138096891
complement(3380)-g, adbSNP:200386972
complement(3381)-t, cdbSNP:150368936
complement(3395)-c, adbSNP:141574412
complement(3437)-g, cdbSNP:147873282
complement(3440)-g, adbSNP:200298289
complement(3476)-t, cdbSNP:140741340
complement(3485)-g, adbSNP:142432519
complement(3522)-g, adbSNP:151051226
complement(3532)-g, cdbSNP:142930680
complement(3540)-t, cdbSNP:148552303
complement(3541)-g, adbSNP:1053602
complement(3577)-t, gdbSNP:79170800
complement(3622)-g, adbSNP:143116557
complement(3631)-c, adbSNP:34311364
complement(3632)-g, adbSNP:61740456
complement(3642)-t, cdbSNP:139134927
complement(3670)-t, adbSNP:139820576
complement(3691)-t, cdbSNP:150950099
complement(3759)-t, cdbSNP:199732388
complement(3776)-t, gdbSNP:201609098
complement(3793)-g, adbSNP:200440885
complement(3881)-g, adbSNP:191144977
complement(3961)-t, cdbSNP:61749192
complement(3988)-t, cdbSNP:35342866
complement(4038)-g, adbSNP:150527387
complement(4099)-t, cdbSNP:200541233
complement(4102)-g, adbSNP:141746240
complement(4115)-g, cdbSNP:148028476
complement(4178)-c, adbSNP:187942922
complement(4204)-g, adbSNP:147440770
complement(4206)-g, cdbSNP:200358741
complement(4255)-t, cdbSNP:201233049
complement(4267)-g, adbSNP:201462928
complement(4288)-g, adbSNP:142885887
complement(4294)-t, cdbSNP:139087745
complement(4297)-g, adbSNP:34175433
complement(4353)-g, cdbSNP:17856414
complement(4360)-g, cdbSNP:199514945
complement(4374)-t, cdbSNP:200459440
complement(4396)-t, cdbSNP:142323055
complement(4501)-t, cdbSNP:35567912
complement(4590)-t, cdbSNP:201910032
complement(4594)-g, adbSNP:1053603
complement(4607)-g, cdbSNP:111576201
complement(4618)-g, adbSNP:150422543
complement(4673)-t, cdbSNP:201967887
complement(4771)-g, adbSNP:140567236
complement(4796)-dbSNP:
complement(4796)-t, cdbSNP:200067496
complement(4804)-t, cdbSNP:151297751
complement(4810)-t, cdbSNP:200359938
complement(4852)-dbSNP:
complement(4852)-g, adbSNP:201335437
complement(4934)-dbSNP:
complement(4934)-g, adbSNP:201665542
complement(4944)-t, gdbSNP:199899150
complement(4992)-g, adbSNP:200733089
complement(4996)-t, cdbSNP:143949849
complement(5019)-dbSNP:
complement(5019)-t, cdbSNP:141429131
complement(5057)-t, gdbSNP:200848728
complement(5073)-t, cdbSNP:113191324
complement(5078)-g, adbSNP:146623915
complement(5084)-g, adbSNP:143183094
complement(5089)-t, cdbSNP:148604464
complement(5192)-g, adbSNP:199835367
complement(5213)-g, adbSNP:74985106
complement(5256)-dbSNP:
complement(5256)-t, cdbSNP:149900976
complement(5292)-g, adbSNP:139169825
complement(5300)-g, adbSNP:200574487
complement(5423)-dbSNP:
complement(5423)-t, cdbSNP:201074875
complement(5428)-g, adbSNP:201637592
complement(5456)-g, adbSNP:200233406
complement(5457)-t, cdbSNP:149588226
complement(5460)-t, cdbSNP:11538640
complement(5489)-g, adbSNP:200148571
complement(5497)-g, adbSNP:200576707
complement(5501)-g, adbSNP:61741222
complement(5548)-g, adbSNP:142782100
complement(5555)-t, cdbSNP:61744204
complement(5557)-g, adbSNP:147210888
complement(5572)-t, cdbSNP:61744213
complement(5573)-t, cdbSNP:148082297
complement(5576)-g, adbSNP:143730967
complement(5577)-t, cdbSNP:146335857
complement(5586)-t, cdbSNP:148953957
complement(5598)-t, cdbSNP:138756464
complement(5645)-dbSNP:
complement(5645)-t, cdbSNP:7949430
complement(5663)-t, cdbSNP:186121470
complement(5673)-g, cdbSNP:141331520
complement(5678)-g, adbSNP:35586429
complement(5685)-t, g, adbSNP:144484956
complement(5688)-t, gdbSNP:11538642
complement(5689)-c, adbSNP:140742013
complement(5699)-g, cdbSNP:150929452
complement(5748)-t, cdbSNP:142589474
complement(5801)-g, adbSNP:148430833
complement(5826)-t, cdbSNP:114826188
complement(5836)-g, cdbSNP:200321459
complement(5839)-g, adbSNP:61745941
complement(5874)-dbSNP:
complement(5874)-g, cdbSNP:140479977
complement(5931)-g, adbSNP:147227616
complement(5949)-t, cdbSNP:149533566
complement(6008)-dbSNP:
complement(6008)-g, adbSNP:61749191
complement(6068)-t, cdbSNP:11538643
complement(6091)-g, adbSNP:139277780
complement(6131)-g, adbSNP:35681270
complement(6153)-c, adbSNP:11538644
complement(6196)-dbSNP:
complement(6196)-t, gdbSNP:141392984
complement(6206)-t, cdbSNP:11538639
complement(6220)-c, adbSNP:11538641
complement(6222)-t, cdbSNP:200315034
complement(6227)-g, adbSNP:138878450
complement(6232)-g, adbSNP:145040216
complement(6239)-g, adbSNP:202117024
complement(6302)-dbSNP:
complement(6302)-g, adbSNP:199699067
complement(6303)-t, cdbSNP:201385605
complement(6305)-g, adbSNP:113245212
complement(6312)-g, adbSNP:142985752
complement(6317)-t, cdbSNP:5743685
complement(6367)-t, cdbSNP:138403313
complement(6393)-t, gdbSNP:143840948
complement(6413)-g, adbSNP:149006752
complement(6435)-g, adbSNP:145842252
complement(6436)-t, cdbSNP:150300331
complement(6451)-g, adbSNP:114134799
complement(6460)-g, adbSNP:5743684
complement(6496)-t, cdbSNP:111829660
complement(6534)-dbSNP:
complement(6534)-g, cdbSNP:148825653
complement(6536)-g, cdbSNP:192702783
complement(6541)-c, adbSNP:199509569
complement(6565)-c, adbSNP:949323
complement(6567)-g, cdbSNP:949324
complement(6649)-g, adbSNP:5743680
complement(6661)-t, cdbSNP:188396458
complement(6701)-g, adbSNP:145493194
complement(6881)-g, adbSNP:1053725
complement(7003)-g, adbSNP:183062716
complement(7015)-g, adbSNP:1541304
complement(7060)-g, adbSNP:5743679
complement(7076)-g, adbSNP:3168177
complement(7124)-g, adbSNP:190921526
complement(7125)-t, cdbSNP:78932475
complement(7140)-t, cdbSNP:14537
Gene SymbolNUMA1
Gene SynonymNUMA
Chromosome11
Locus Map11q13
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_006185 Homo sapiens nuclear mitotic apparatus protein 1 (NUMA1), mRNA. Full Length $3231.90
ORF Sequence $2856.60
Title GAS41 amplification results in overexpression of a new spindle pole protein .
Author Schmitt,J., Fischer,U., Heisel,S., Strickfaden,H., Backes,C., Ruggieri,A., Keller,A., Chang,P. and Meese,E.
Journal Genes Chromosomes Cancer 51 (9), 868-880 (2012)
Title Error-prone mammalian female meiosis from silencing the spindle assembly checkpoint without normal interkinetochore tension .
Author Kolano,A., Brunet,S., Silk,A.D., Cleveland,D.W. and Verlhac,M.H.
Journal Proc. Natl. Acad. Sci. U.S.A. 109 (27), E1858-E1867 (2012)
Title Early apoptotic reorganization of spliceosomal proteins involves caspases, CAD and rearrangement of NuMA .
Author Dieker,J., Iglesias-Guimarais,V., Decossas,M., Stevenin,J., van der Vlag,J., Yuste,V.J. and Muller,S.
Journal Traffic 13 (2), 257-272 (2012)
Title NuMA overexpression in epithelial ovarian cancer .
Author Bruning-Richardson,A., Bond,J., Alsiary,R., Richardson,J., Cairns,D.A., McCormac,L., Hutson,R., Burns,P.A., Wilkinson,N., Hall,G.D., Morrison,E.E. and Bell,S.M.
Journal PLoS ONE 7 (6), E38945 (2012)
Title Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method .
Author Oshikawa,M., Tsutsui,C., Ikegami,T., Fuchida,Y., Matsubara,M., Toyama,S., Usami,R., Ohtoko,K. and Kato,S.
Journal Invest. Ophthalmol. Vis. Sci. 52 (9), 6662-6670 (2011)
Title Mutation of the predicted p34cdc2 phosphorylation sites in NuMA impair the assembly of the mitotic spindle and block mitosis .
Author Compton,D.A. and Luo,C.
Journal J. Cell. Sci. 108 (PT 2), 621-633 (1995)
Title Assignment of the nuclear mitotic apparatus protein NuMA gene to human chromosome 11q13 .
Author Sparks,C.A., Bangs,P.L., McNeil,G.P., Lawrence,J.B. and Fey,E.G.
Journal Genomics 17 (1), 222-224 (1993)
Title Primary structure of NuMA, an intranuclear protein that defines a novel pathway for segregation of proteins at mitosis .
Author Compton,D.A., Szilak,I. and Cleveland,D.W.
Journal J. Cell Biol. 116 (6), 1395-1408 (1992)
Title NuMA: an unusually long coiled-coil related protein in the mammalian nucleus .
Author Yang,C.H., Lambie,E.J. and Snyder,M.
Journal J. Cell Biol. 116 (6), 1303-1317 (1992)
Title Human-specific nuclear protein that associates with the polar region of the mitotic apparatus: distribution in a human/hamster hybrid cell .
Author Lydersen,B.K. and Pettijohn,D.E.
Journal Cell 22 (2 PT 2), 489-499 (1980)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878