• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens nuclear mitotic apparatus protein 1 (NUMA1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_006185 Homo sapiens nuclear mitotic apparatus protein 1 (NUMA1), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $3749.00 35

*Business Day

Related Services

RefSeq Version NM_006185.3, 557440897
Length 7375 bp
Structure linear
Update Date 11-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens nuclear mitotic apparatus protein 1 (NUMA1), transcript variant 1, mRNA.
Product nuclear mitotic apparatus protein 1 isoform 1
Comment

Summary: This gene encodes a large protein that forms a structural component of the nuclear matrix. The encoded protein interacts with microtubules and plays a role in the formation and organization of the mitotic spindle during cell division. Chromosomal translocation of this gene with the RARA (retinoic acid receptor, alpha) gene on chromosome 17 have been detected in patients with acute promyelocytic leukemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longer isoform (1).

RefSeq NP_006176.2
CDS 339..6686
Misc Feature(1)318..320
Misc Feature(2)339..974
Misc Feature(3)339..974
Misc Feature(4)771..3296
Misc Feature(5)843..845
Misc Feature(6)843..845
Misc Feature(7)852..854
Misc Feature(8)936..938
Misc Feature(9)945..947
Misc Feature(10)945..947
Misc Feature(11)969..971
Misc Feature(12)969..971
Misc Feature(13)1149..1151
Misc Feature(14)1203..1205
Misc Feature(15)1473..1475
Misc Feature(16)1500..1502
Misc Feature(17)1500..1502
Misc Feature(18)1521..1523
Misc Feature(19)1521..1523
Misc Feature(20)1569..1571
Misc Feature(21)<2028..2465
Misc Feature(22)2427..5162
Misc Feature(23)2796..2798
Misc Feature(24)2796..2798
Misc Feature(25)3009..3011
Misc Feature(26)3225..3227
Misc Feature(27)3897..3899
Misc Feature(28)4011..4013
Misc Feature(29)4122..4124
Misc Feature(30)4869..4871
Misc Feature(31)5139..5141
Misc Feature(32)5139..5141
Misc Feature(33)5436..6683
Misc Feature(34)5499..5501
Misc Feature(35)5499..5501
Misc Feature(36)5508..5510
Misc Feature(37)5508..5510
Misc Feature(38)5520..5522
Misc Feature(39)5520..5522
Misc Feature(40)5535..5537
Misc Feature(41)5607..5609
Misc Feature(42)5607..5609
Misc Feature(43)5607..5609
Misc Feature(44)5616..5618
Misc Feature(45)5616..5618
Misc Feature(46)5643..5645
Misc Feature(47)5643..5645
Misc Feature(48)5652..5654
Misc Feature(49)5652..5654
Misc Feature(50)5658..5660
Misc Feature(51)5658..5660
Misc Feature(52)5664..5666
Misc Feature(53)5664..5666
Misc Feature(54)5700..5702
Misc Feature(55)5703..5705
Misc Feature(56)5712..5714
Misc Feature(57)5736..5738
Misc Feature(58)5748..5750
Misc Feature(59)5826..5828
Misc Feature(60)5826..5828
Misc Feature(61)5835..5837
Misc Feature(62)5835..5837
Misc Feature(63)5838..5840
Misc Feature(64)5838..5840
Misc Feature(65)5844..5846
Misc Feature(66)5847..5849
Misc Feature(67)5856..5858
Misc Feature(68)5895..5897
Misc Feature(69)5922..5924
Misc Feature(70)5922..5924
Misc Feature(71)5931..5933
Misc Feature(72)5934..6146
Misc Feature(73)5940..5942
Misc Feature(74)5952..5954
Misc Feature(75)5997..5999
Misc Feature(76)6171..6173
Misc Feature(77)6243..6245
Misc Feature(78)6288..6305
Misc Feature(79)6309..6311
Misc Feature(80)6336..6338
Misc Feature(81)6336..6338
Misc Feature(82)6336..6338
Misc Feature(83)6345..6347
Misc Feature(84)6345..6347
Misc Feature(85)6381..6383
Misc Feature(86)6501..6503
Misc Feature(87)6567..6569
Misc Feature(88)6597..6599
Misc Feature(89)6654..6656
Exon (1)1..236
Gene:NUMA1
Gene Synonym:NUMA
Exon (2)237..306
Gene:NUMA1
Gene Synonym:NUMA
Exon (3)307..380
Gene:NUMA1
Gene Synonym:NUMA
Exon (4)381..466
Gene:NUMA1
Gene Synonym:NUMA
Exon (5)467..546
Gene:NUMA1
Gene Synonym:NUMA
Exon (6)547..629
Gene:NUMA1
Gene Synonym:NUMA
Exon (7)630..710
Gene:NUMA1
Gene Synonym:NUMA
Exon (8)711..798
Gene:NUMA1
Gene Synonym:NUMA
Exon (9)799..922
Gene:NUMA1
Gene Synonym:NUMA
Exon (10)923..1080
Gene:NUMA1
Gene Synonym:NUMA
Exon (11)1081..1198
Gene:NUMA1
Gene Synonym:NUMA
Exon (12)1199..1316
Gene:NUMA1
Gene Synonym:NUMA
Exon (13)1317..1457
Gene:NUMA1
Gene Synonym:NUMA
Exon (14)1458..1580
Gene:NUMA1
Gene Synonym:NUMA
Exon (15)1581..4946
Gene:NUMA1
Gene Synonym:NUMA
Exon (16)4947..4988
Gene:NUMA1
Gene Synonym:NUMA
Exon (17)4989..5057
Gene:NUMA1
Gene Synonym:NUMA
Exon (18)5058..5177
Gene:NUMA1
Gene Synonym:NUMA
Exon (19)5178..5396
Gene:NUMA1
Gene Synonym:NUMA
Exon (20)5397..5554
Gene:NUMA1
Gene Synonym:NUMA
Exon (21)5555..5801
Gene:NUMA1
Gene Synonym:NUMA
Exon (22)5802..6030
Gene:NUMA1
Gene Synonym:NUMA
Exon (23)6031..6167
Gene:NUMA1
Gene Synonym:NUMA
Exon (24)6168..6344
Gene:NUMA1
Gene Synonym:NUMA
Exon (25)6345..6461
Gene:NUMA1
Gene Synonym:NUMA
Exon (26)6462..6674
Gene:NUMA1
Gene Synonym:NUMA
Exon (27)6675..7349
Gene:NUMA1
Gene Synonym:NUMA
Translation MTLHATRGAALLSWVNSLHVADPVEAVLQLQDCSIFIKIIDRIHGTEEGQQILKQPVSER LDFVCSFLQKNRKHPSSPECLVSAQKVLEGSELELAKMTMLLLYHSTMSSKSPRDWEQFE YKIQAELAVILKFVLDHEDGLNLNEDLENFLQKAPVPSTCSSTFPEELSPPSHQAKREIR FLELQKVASSSSGNNFLSGSPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAEN RKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKELEELRDKNESLTMRLHETLKQCQ DLKTEKSQMDRKINQLSEENGDLSFKLREFASHLQQLQDALNELTEEHSKATQEWLEKQA QLEKELSAALQDKKCLEEKNEILQGKLSQLEEHLSQLQDNPPQEKGEVLGDVLQLETLKQ EAATLAANNTQLQARVEMLETERGQQEAKLLAERGHFEEEKQQLSSLITDLQSSISNLSQ AKEELEQASQAHGARLTAQVASLTSELTTLNATIQQQDQELAGLKQQAKEKQAQLAQTLQ QQEQASQGLRHQVEQLSSSLKQKEQQLKEVAEKQEATRQDHAQQLATAAEEREASLRERD AALKQLEALEKEKAAKLEILQQQLQVANEARDSAQTSVTQAQREKAELSRKVEELQACVE TARQEQHEAQAQVAELELQLRSEQQKATEKERVAQEKDQLQEQLQALKESLKVTKGSLEE EKRRAADALEEQQRCISELKAETRSLVEQHKRERKELEEERAGRKGLEARLQQLGEAHQA ETEVLRRELAEAMAAQHTAESECEQLVKEVAAWRERYEDSQQEEAQYGAMFQEQLMTLKE ECEKARQELQEAKEKVAGIESHSELQISRQQNELAELHANLARALQQVQEKEVRAQKLAD DLSTLQEKMAATSKEVARLETLVRKAGEQQETASRELVKEPARAGDRQPEWLEEQQGRQF CSTQAALQAMEREAEQMGNELERLRAALMESQGQQQEERGQQEREVARLTQERGRAQADL ALEKAARAELEMRLQNALNEQRVEFATLQEALAHALTEKEGKDQELAKLRGLEAAQIKEL EELRQTVKQLKEQLAKKEKEHASGSGAQSEAAGRTEPTGPKLEALRAEVSKLEQQCQKQQ EQADSLERSLEAERASRAERDSALETLQGQLEEKAQELGHSQSALASAQRELAAFRTKVQ DHSKAEDEWKAQVARGRQEAERKNSLISSLEEEVSILNRQVLEKEGESKELKRLVMAESE KSQKLEERLRLLQAETASNSARAAERSSALREEVQSLREEAEKQRVASENLRQELTSQAE RAEELGQELKAWQEKFFQKEQALSTLQLEHTSTQALVSELLPAKHLCQQLQAEQAAAEKR HREELEQSKQAAGGLRAELLRAQRELGELIPLRQKVAEQERTAQQLRAEKASYAEQLSML KKAHGLLAEENRGLGERANLGRQFLEVELDQAREKYVQELAAVRADAETRLAEVQREAQS TARELEVMTAKYEGAKVKVLEERQRFQEERQKLTAQVEQLEVFQREQTKQVEELSKKLAD SDQASKVQQQKLKAVQAQGGESQQEAQRLQAQLNELQAQLSQKEQAAEHYKLQMEKAKTH YDAKKQQNQELQEQLRSLEQLQKENKELRAEAERLGHELQQAGLKTKEAEQTCRHLTAQV RSLEAQVAHADQQLRDLGKFQVATDALKSREPQAKPQLDLSIDSLDLSCEEGTPLSITSK LPRTQPDGTSVPGEPASPISQRLPPKVESLESLYFTPIPARSQAPLESSLDSLGDVFLDS GRKTRSARRRTTQIINITMTKKLDVEEPDSANSSFYSTRSAPASQASLRATSSTQSLARL GSPDYGNSALLSLPGYRPTTRSSARRSQAGVSSGAPPGRNSFYMGTCQDEPEQLDDWNRI AELQQRNRVCPPHLKTCYPLESRPSLSLGTITDEEMKTGDPQETLRRASMQPIQIAEGTG ITTRQQRKRVSLEPHQGPGTPESKKATSCFPRPMTPRDRHEGRKQSTTEAQKKAAPASTK QADRRQSMAFSILNTPKKLGNSLLRRGASKKALSKASPNTRSGTRRSPRIATTTASAATA AAIGATPRAKGKAKH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(13)-dbSNP:
complement(13)-t, adbSNP:190307646
complement(89)-g, adbSNP:111537544
complement(230)-g, adbSNP:114912925
complement(308)-dbSNP:
complement(308)-g, adbSNP:371279810
complement(337)-t, cdbSNP:149620306
complement(347)-g, cdbSNP:138259504
complement(352)-g, adbSNP:147122825
complement(353)-g, adbSNP:369168241
complement(355)-g, adbSNP:375096456
complement(357)-g, adbSNP:143306302
complement(358)-t, cdbSNP:201524124
complement(452)-dbSNP:
complement(452)-t, cdbSNP:371984458
complement(469)-dbSNP:
complement(469)-t, cdbSNP:199851967
complement(480)-t, cdbSNP:376968500
complement(493)-t, adbSNP:137956915
complement(506)-t, cdbSNP:146932177
complement(510)-g, adbSNP:373792229
complement(527)-g, adbSNP:370577971
complement(552)-dbSNP:
complement(552)-g, cdbSNP:141726451
complement(559)-t, gdbSNP:140051813
complement(578)-g, adbSNP:373903675
complement(580)-t, adbSNP:201872246
complement(623)-t, cdbSNP:113315375
complement(625)-g, adbSNP:151173629
complement(635)-dbSNP:
complement(635)-g, adbSNP:143065802
complement(648)-g, adbSNP:200895025
complement(662)-t, cdbSNP:149868280
complement(698)-t, cdbSNP:146482232
complement(755)-dbSNP:
complement(755)-g, adbSNP:141785503
complement(756)-t, cdbSNP:140405205
complement(773)-t, cdbSNP:368771685
complement(814)-dbSNP:
complement(814)-g, adbSNP:146743068
complement(818)-c, adbSNP:374754809
complement(830)-t, gdbSNP:149775256
complement(847)-g, adbSNP:199958172
complement(876)-g, adbSNP:139676280
complement(898)-g, adbSNP:150648243
complement(907)-g, adbSNP:370357335
complement(911)-g, adbSNP:201565115
complement(973)-dbSNP:
complement(973)-t, gdbSNP:78911887
complement(974)-t, gdbSNP:78805600
complement(990)-g, adbSNP:142862862
complement(1063)-t, cdbSNP:34239655
complement(1076)-c, adbSNP:139072829
complement(1108)-dbSNP:
complement(1108)-t, cdbSNP:190582413
complement(1116)-g, adbSNP:376405900
complement(1123)-g, adbSNP:147509804
complement(1124)-g, cdbSNP:372068450
complement(1144)-g, adbSNP:368732432
complement(1145)-t, cdbSNP:201045195
complement(1183)-t, cdbSNP:371267182
complement(1185)-t, cdbSNP:143164985
complement(1224)-dbSNP:
complement(1224)-g, cdbSNP:370693844
complement(1264)-t, adbSNP:368144747
complement(1269)-g, adbSNP:139359161
complement(1280)-g, cdbSNP:147316914
complement(1289)-t, cdbSNP:370844544
complement(1293)-t, cdbSNP:376347499
complement(1319)-dbSNP:
complement(1319)-t, cdbSNP:143260427
complement(1320)-g, adbSNP:370294640
complement(1321)-t, cdbSNP:139891320
complement(1338)-g, cdbSNP:200581089
complement(1363)-t, cdbSNP:371150785
complement(1368)-g, cdbSNP:117729282
complement(1371)-t, adbSNP:150123720
complement(1373)-t, cdbSNP:140773501
complement(1376)-t, cdbSNP:61749193
complement(1420)-t, cdbSNP:200776294
complement(1437)-t, cdbSNP:137910688
complement(1439)-g, adbSNP:201583885
complement(1478)-dbSNP:
complement(1478)-g, adbSNP:142927239
complement(1556)-g, adbSNP:369612298
complement(1566)-t, cdbSNP:145461809
complement(1581)-dbSNP:
complement(1581)-g, cdbSNP:200242038
complement(1665)-g, cdbSNP:140321664
complement(1666)-t, cdbSNP:34335618
complement(1702)-t, c, adbSNP:34441100
complement(1727)-g, cdbSNP:142208518
complement(1734)-t, gdbSNP:200749852
complement(1745)-t, adbSNP:149147440
complement(1749)-g, adbSNP:369583358
complement(1764)-g, adbSNP:371678243
complement(1768)-t, cdbSNP:145185561
complement(1772)-g, adbSNP:369004761
complement(1796)-t, cdbSNP:200361756
complement(1824)-g, adbSNP:375966632
complement(1890)-g, cdbSNP:375312614
complement(1905)-t, cdbSNP:139983316
complement(1960)-t, cdbSNP:61756007
complement(1979)-g, cdbSNP:147473107
complement(1990)-t, cdbSNP:200470926
complement(2009)-g, adbSNP:201184219
complement(2051)-t, cdbSNP:368133521
complement(2054)-t, cdbSNP:144839807
complement(2081)-g, adbSNP:374216599
complement(2102)-g, adbSNP:17161802
complement(2113)-t, cdbSNP:147334088
complement(2122)-g, adbSNP:371974605
complement(2128)-c, adbSNP:142002151
complement(2178)-g, cdbSNP:148204936
complement(2230)-t, cdbSNP:371790545
complement(2232)-t, cdbSNP:143872566
complement(2236)-t, cdbSNP:201059127
complement(2265)-g, adbSNP:149446307
complement(2294)-t, cdbSNP:137943559
complement(2369)-g, cdbSNP:199958873
complement(2379)-g, adbSNP:368335812
complement(2380)-t, cdbSNP:376591300
complement(2384)-g, adbSNP:145314839
complement(2501)-t, cdbSNP:200446758
complement(2506)-t, cdbSNP:372250812
complement(2508)-t, cdbSNP:138657430
complement(2516)-t, cdbSNP:370348490
complement(2560)-g, cdbSNP:185327928
complement(2568)-g, cdbSNP:201001720
complement(2576)-g, cdbSNP:150177622
complement(2592)-g, adbSNP:367866725
complement(2618)-t, cdbSNP:140880451
2653+a, tdbSNP:1053600
complement(2659)-c, adbSNP:201697611
2675+a, gdbSNP:3750912
complement(2698)-t, cdbSNP:200110896
2719+c, gdbSNP:3750913
complement(2729)-g, cdbSNP:370806373
complement(2740)-t, cdbSNP:141508454
complement(2744)-g, cdbSNP:376719518
complement(2765)-t, adbSNP:143000254
complement(2822)-g, adbSNP:36029905
complement(2827)-g, adbSNP:371026819
complement(2885)-t, cdbSNP:377529491
complement(2899)-t, gdbSNP:200650100
complement(2943)-g, adbSNP:140958526
2955+a, gdbSNP:1053601
complement(2997)-g, cdbSNP:187108019
complement(3069)-c, adbSNP:201829820
complement(3074)-t, gdbSNP:368955060
complement(3090)-g, adbSNP:61756008
complement(3091)-t, cdbSNP:143299097
complement(3133)-g, adbSNP:372820204
complement(3141)-g, adbSNP:183576691
complement(3161)-g, adbSNP:369564859
complement(3196)-t, cdbSNP:201383824
complement(3252)-g, adbSNP:200653308
complement(3253)-t, cdbSNP:149184541
complement(3270)-t, cdbSNP:11235419
complement(3275)-g, adbSNP:142372284
complement(3291)-g, adbSNP:376856904
complement(3292)-t, cdbSNP:139068712
complement(3296)-g, adbSNP:200722845
complement(3307)-t, cdbSNP:146223910
complement(3358)-g, adbSNP:141626208
complement(3375)-g, adbSNP:372578021
complement(3381)-g, adbSNP:201363056
complement(3435)-g, adbSNP:370339752
complement(3436)-t, cdbSNP:200911497
complement(3465)-t, cdbSNP:370201182
complement(3485)-t, cdbSNP:138719127
complement(3490)-g, adbSNP:150479005
complement(3491)-t, cdbSNP:202246796
complement(3501)-c, adbSNP:149499808
complement(3527)-g, adbSNP:376749234
complement(3530)-t, cdbSNP:138096891
complement(3546)-g, adbSNP:200386972
complement(3547)-t, cdbSNP:150368936
complement(3552)-g, adbSNP:375753509
complement(3561)-c, adbSNP:141574412
complement(3603)-g, cdbSNP:147873282
complement(3606)-t, g, adbSNP:200298289
complement(3628)-t, cdbSNP:374995187
complement(3641)-g, adbSNP:371995978
complement(3642)-t, cdbSNP:140741340
complement(3644)-t, adbSNP:374194186
complement(3651)-g, adbSNP:142432519
complement(3688)-g, adbSNP:151051226
complement(3698)-g, cdbSNP:142930680
complement(3706)-t, cdbSNP:148552303
3707+a, gdbSNP:1053602
complement(3743)-t, gdbSNP:79170800
complement(3772)-t, cdbSNP:371247021
complement(3780)-g, adbSNP:376861788
complement(3788)-g, adbSNP:143116557
complement(3797)-c, adbSNP:34311364
complement(3798)-g, adbSNP:61740456
complement(3808)-t, cdbSNP:139134927
complement(3831)-g, cdbSNP:371146539
complement(3836)-t, adbSNP:139820576
complement(3857)-t, cdbSNP:150950099
complement(3886)-t, cdbSNP:372126200
complement(3907)-t, cdbSNP:375662470
complement(3925)-t, cdbSNP:199732388
complement(3942)-t, gdbSNP:201609098
complement(3959)-g, adbSNP:200440885
complement(3986)-g, adbSNP:377202638
complement(4047)-g, adbSNP:191144977
complement(4053)-g, adbSNP:373028376
complement(4061)-g, cdbSNP:374390931
complement(4073)-c, adbSNP:374109028
complement(4074)-t, cdbSNP:370530216
complement(4127)-t, cdbSNP:61749192
complement(4154)-t, cdbSNP:35342866
complement(4204)-g, adbSNP:150527387
complement(4231)-t, cdbSNP:377293607
complement(4265)-t, cdbSNP:200541233
complement(4268)-g, adbSNP:141746240
complement(4281)-g, cdbSNP:148028476
complement(4344)-c, adbSNP:187942922
complement(4370)-g, adbSNP:147440770
complement(4372)-g, cdbSNP:200358741
complement(4383)-t, cdbSNP:370046141
complement(4398)-g, cdbSNP:377750338
complement(4421)-t, cdbSNP:201233049
complement(4433)-g, adbSNP:201462928
complement(4454)-g, adbSNP:142885887
complement(4460)-t, cdbSNP:139087745
complement(4463)-g, adbSNP:34175433
complement(4510)-g, adbSNP:368983626
complement(4519)-g, cdbSNP:17856414
complement(4526)-g, cdbSNP:199514945
complement(4540)-t, cdbSNP:200459440
complement(4562)-t, cdbSNP:142323055
complement(4629)-t, cdbSNP:370967498
complement(4667)-t, cdbSNP:35567912
complement(4700)-t, cdbSNP:373339912
complement(4756)-t, cdbSNP:201910032
4760+a, gdbSNP:1053603
complement(4769)-g, adbSNP:377634573
complement(4771)-t, cdbSNP:374216163
complement(4773)-g, cdbSNP:111576201
complement(4776)-g, adbSNP:369816132
complement(4784)-g, adbSNP:150422543
complement(4839)-t, cdbSNP:201967887
complement(4898)-g, cdbSNP:377260378
complement(4912)-t, cdbSNP:371269790
complement(4937)-g, adbSNP:140567236
complement(4955)-dbSNP:
complement(4955)-g, cdbSNP:375099118
complement(4962)-t, cdbSNP:200067496
complement(4970)-t, cdbSNP:151297751
complement(4974)-g, cdbSNP:368123435
complement(4976)-t, cdbSNP:200359938
complement(5003)-dbSNP:
complement(5003)-g, adbSNP:368515813
complement(5018)-g, adbSNP:201335437
complement(5061)-dbSNP:
complement(5061)-t, cdbSNP:367669696
complement(5078)-g, adbSNP:373783724
complement(5100)-g, adbSNP:201665542
complement(5110)-t, gdbSNP:199899150
complement(5138)-g, cdbSNP:377582864
complement(5158)-g, adbSNP:200733089
complement(5162)-t, cdbSNP:143949849
complement(5185)-dbSNP:
complement(5185)-t, cdbSNP:141429131
complement(5223)-t, gdbSNP:200848728
complement(5239)-t, cdbSNP:113191324
complement(5244)-g, adbSNP:146623915
complement(5245)-t, cdbSNP:374025319
complement(5250)-g, adbSNP:143183094
complement(5255)-t, cdbSNP:148604464
complement(5299)-t, cdbSNP:370993967
complement(5358)-g, adbSNP:199835367
complement(5368)-g, adbSNP:373890469
complement(5379)-g, adbSNP:74985106
complement(5412)-dbSNP:
complement(5412)-g, cdbSNP:372668064
complement(5422)-t, cdbSNP:149900976
complement(5430)-c, adbSNP:374970264
complement(5435)-t, cdbSNP:375669993
complement(5458)-g, adbSNP:139169825
complement(5466)-g, adbSNP:200574487
complement(5577)-dbSNP:
complement(5577)-g, cdbSNP:368761248
complement(5589)-t, cdbSNP:201074875
complement(5594)-g, adbSNP:201637592
complement(5622)-g, adbSNP:200233406
complement(5623)-t, cdbSNP:149588226
complement(5624)-g, adbSNP:370243645
5626+c, tdbSNP:11538640
complement(5655)-g, adbSNP:200148571
complement(5663)-g, adbSNP:200576707
complement(5667)-g, adbSNP:61741222
complement(5706)-g, cdbSNP:367864451
complement(5714)-g, adbSNP:142782100
complement(5721)-t, cdbSNP:61744204
complement(5723)-g, adbSNP:147210888
complement(5738)-t, cdbSNP:61744213
complement(5739)-t, cdbSNP:148082297
complement(5742)-g, adbSNP:143730967
complement(5743)-t, cdbSNP:146335857
complement(5750)-g, adbSNP:374713743
complement(5751)-g, adbSNP:375276945
complement(5752)-t, cdbSNP:148953957
complement(5764)-t, cdbSNP:138756464
complement(5811)-dbSNP:
complement(5811)-t, cdbSNP:7949430
complement(5829)-t, cdbSNP:186121470
complement(5839)-g, cdbSNP:141331520
complement(5844)-g, adbSNP:35586429
complement(5851)-t, g, adbSNP:144484956
complement(5853)-g, adbSNP:367629814
5854+g, tdbSNP:11538642
complement(5855)-c, adbSNP:140742013
complement(5865)-g, cdbSNP:150929452
complement(5914)-t, cdbSNP:142589474
complement(5928)-t, cdbSNP:371428040
complement(5967)-g, adbSNP:148430833
complement(5968)-t, cdbSNP:372962203
complement(5992)-t, cdbSNP:114826188
complement(5992)-g, adbSNP:386432893
complement(5994)-g, adbSNP:368954884
complement(6002)-g, cdbSNP:200321459
complement(6005)-g, adbSNP:61745941
complement(6040)-dbSNP:
complement(6040)-g, cdbSNP:140479977
complement(6059)-g, adbSNP:372053188
complement(6097)-g, adbSNP:147227616
complement(6115)-t, cdbSNP:149533566
complement(6174)-dbSNP:
complement(6174)-g, adbSNP:61749191
complement(6178)-t, cdbSNP:375877239
6234+c, tdbSNP:11538643
complement(6257)-g, adbSNP:139277780
complement(6266)-g, adbSNP:367669125
complement(6269)-g, cdbSNP:371124702
complement(6297)-g, adbSNP:35681270
complement(6298)-t, cdbSNP:374984536
complement(6311)-g, adbSNP:371991827
6319+a, cdbSNP:11538644
complement(6337)-g, adbSNP:368138406
complement(6362)-dbSNP:
complement(6362)-t, gdbSNP:141392984
6372+c, tdbSNP:11538639
6386+a, cdbSNP:11538641
complement(6388)-t, cdbSNP:200315034
complement(6393)-g, adbSNP:138878450
complement(6398)-g, adbSNP:145040216
complement(6405)-g, adbSNP:202117024
complement(6406)-t, cdbSNP:377424025
complement(6468)-dbSNP:
complement(6468)-g, adbSNP:199699067
complement(6469)-t, cdbSNP:201385605
complement(6471)-g, adbSNP:113245212
complement(6478)-g, adbSNP:142985752
complement(6483)-t, cdbSNP:5743685
complement(6531)-g, adbSNP:369599832
complement(6533)-t, cdbSNP:138403313
complement(6559)-t, gdbSNP:143840948
complement(6579)-g, adbSNP:149006752
complement(6591)-g, adbSNP:370795965
complement(6601)-g, adbSNP:145842252
complement(6602)-t, cdbSNP:150300331
complement(6617)-g, adbSNP:114134799
complement(6626)-g, adbSNP:5743684
complement(6627)-t, cdbSNP:371005806
complement(6629)-g, adbSNP:377519577
complement(6631)-g, adbSNP:371530212
complement(6642)-t, cdbSNP:376020708
complement(6662)-t, cdbSNP:111829660
complement(6700)-dbSNP:
complement(6700)-g, cdbSNP:148825653
complement(6702)-g, cdbSNP:192702783
complement(6707)-c, adbSNP:199509569
complement(6713)-g, adbSNP:375109629
complement(6718)-t, cdbSNP:372495840
complement(6731..6733)-ggt, cggdbSNP:386754843
6731+a, cdbSNP:949323
complement(6731)-c, adbSNP:386622975
6733+c, gdbSNP:949324
complement(6803)-g, adbSNP:376421361
complement(6815)-g, adbSNP:5743680
complement(6827)-t, cdbSNP:188396458
complement(6867)-g, adbSNP:145493194
complement(6875)-c, adbSNP:369577784
complement(6879)-, tdbSNP:372286018
7047+a, gdbSNP:1053725
complement(7169)-g, adbSNP:183062716
complement(7174)-t, cdbSNP:375500093
7181+a, gdbSNP:1541304
complement(7226)-g, adbSNP:5743679
7242+a, gdbSNP:3168177
complement(7290)-g, adbSNP:190921526
complement(7291)-t, cdbSNP:78932475
7306+c, tdbSNP:14537
Gene SymbolNUMA1
Gene SynonymNUMA
Chromosome11
Locus Map11q13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006185 Homo sapiens nuclear mitotic apparatus protein 1 (NUMA1), transcript variant 1, mRNA. On-demand $3749.00 35
NM_001286561 Homo sapiens nuclear mitotic apparatus protein 1 (NUMA1), transcript variant 2, mRNA. On-demand $3749.00 35
XM_006718562 PREDICTED: Homo sapiens nuclear mitotic apparatus protein 1 (NUMA1), transcript variant X1, mRNA. On-demand $3749.00 35
XM_006718563 PREDICTED: Homo sapiens nuclear mitotic apparatus protein 1 (NUMA1), transcript variant X2, mRNA. On-demand $3749.00 35
XM_006718564 PREDICTED: Homo sapiens nuclear mitotic apparatus protein 1 (NUMA1), transcript variant X3, mRNA. On-demand $3749.00 35
XM_006718565 PREDICTED: Homo sapiens nuclear mitotic apparatus protein 1 (NUMA1), transcript variant X4, mRNA. On-demand $3749.00 35
XM_006718566 PREDICTED: Homo sapiens nuclear mitotic apparatus protein 1 (NUMA1), transcript variant X5, mRNA. On-demand $3749.00 35
XM_006718567 PREDICTED: Homo sapiens nuclear mitotic apparatus protein 1 (NUMA1), transcript variant X6, mRNA. On-demand $3749.00 35
XM_006718568 PREDICTED: Homo sapiens nuclear mitotic apparatus protein 1 (NUMA1), transcript variant X7, mRNA. On-demand $3749.00 35
XM_006718569 PREDICTED: Homo sapiens nuclear mitotic apparatus protein 1 (NUMA1), transcript variant X8, mRNA. On-demand $3749.00 35
XM_006718570 PREDICTED: Homo sapiens nuclear mitotic apparatus protein 1 (NUMA1), transcript variant X9, mRNA. On-demand $3749.00 35
Title Cell cycle-dependent SUMO-1 conjugation to nuclear mitotic apparatus protein (NuMA) .
Author Seo JS, Kim HN, Kim SJ, Bang J, Kim EA, Sung KS, Yoon HJ, Yoo HY and Choi CY.
Journal Biochem. Biophys. Res. Commun. 443 (1), 259-265 (2014)
Title Par1b links lumen polarity with LGN-NuMA positioning for distinct epithelial cell division phenotypes .
Author Lazaro-Dieguez F, Cohen D, Fernandez D, Hodgson L, van Ijzendoorn
Journal J. Cell Biol. 203 (2), 251-264 (2013)
Title NuMA after 30 years: the matrix revisited .
Author Radulescu AE and Cleveland DW.
Journal Trends Cell Biol. 20 (4), 214-222 (2010)
Title Mutation of the predicted p34cdc2 phosphorylation sites in NuMA impair the assembly of the mitotic spindle and block mitosis .
Author Compton DA and Luo C.
Journal J. Cell. Sci. 108 (PT 2), 621-633 (1995)
Title Nuclear mitotic apparatus protein (NuMA): spindle association, nuclear targeting and differential subcellular localization of various NuMA isoforms .
Author Tang TK, Tang CJ, Chao YJ and Wu CW.
Journal J. Cell. Sci. 107 (PT 6), 1389-1402 (1994)
Title Primary structure and microtubule-interacting domain of the SP-H antigen: a mitotic MAP located at the spindle pole and characterized as a homologous protein to NuMA .
Author Maekawa T and Kuriyama R.
Journal J. Cell. Sci. 105 (PT 2), 589-600 (1993)
Title Nuclear proteins of the bovine esophageal epithelium. II. The NuMA gene gives rise to multiple mRNAs and gene products reactive with monoclonal antibody W1 .
Author Tang TK, Tang CJ, Chen YL and Wu CW.
Journal J. Cell. Sci. 104 (PT 2), 249-260 (1993)
Title Primary structure of NuMA, an intranuclear protein that defines a novel pathway for segregation of proteins at mitosis .
Author Compton DA, Szilak I and Cleveland DW.
Journal J. Cell Biol. 116 (6), 1395-1408 (1992)
Title NuMA: an unusually long coiled-coil related protein in the mammalian nucleus .
Author Yang CH, Lambie EJ and Snyder M.
Journal J. Cell Biol. 116 (6), 1303-1317 (1992)
Title Human-specific nuclear protein that associates with the polar region of the mitotic apparatus: distribution in a human/hamster hybrid cell .
Author Lydersen,B.K. and Pettijohn,D.E.
Journal Cell 22 (2 PT 2), 489-499 (1980)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.