• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens paired box 9 (PAX9), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu22291 Homo sapiens paired box 9 (PAX9), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu22291C Homo sapiens paired box 9 (PAX9), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_006194.3, 260656050
Length 1026 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens paired box 9 (PAX9), mRNA.
Product paired box protein Pax-9
Comment

Summary: This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 9 gene is unknown but it may involve development of stratified squamous epithelia as well as various organs and skeletal elements. [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_006185.1
CDS 727..1752
Misc Feature(1)658..660
Misc Feature(2)742..1119
Misc Feature(3)742..1119
Misc Feature(4)order(751..756,769..771,775..783,787..789,802..804,
Misc Feature(5)802..1110
Misc Feature(6)1228..1293
Exon (1)1..333
Gene:PAX9
Gene Synonym:STHAG3
Exon (2)334..730
Gene:PAX9
Gene Synonym:STHAG3
Exon (3)731..1357
Gene:PAX9
Gene Synonym:STHAG3
Exon (4)1358..1497
Gene:PAX9
Gene Synonym:STHAG3
Exon (5)1498..3107
Gene:PAX9
Gene Synonym:STHAG3
Translation MEPAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARY NETGSILPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSV SSISRILRNKIGNLAQQGHYDSYKQHQPTPQPALPYNHIYSYPSPITAAAAKVPTPPGVP AIPGSVAMPRTWPSSHSVTDILGIRSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHA VNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGH GWQHAGGTSLSPHNCDIPASLAFKGMQAAREGSHSVTASAL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
8+dbSNP:
8+c, tdbSNP:147254306
16+g, tdbSNP:149623673
47+g, tdbSNP:375641068
71+c, gdbSNP:374248332
complement(83)-g, adbSNP:147293671
99..100+, cdbSNP:11373281
101..102+, cdbSNP:397830943
272+c, gdbSNP:4904155
289+a, tdbSNP:188648745
552+dbSNP:
552+c, gdbSNP:144429269
623+c, tdbSNP:375990805
704+a, gdbSNP:201198716
710+g, tdbSNP:369190149
756+dbSNP:
756+a, gdbSNP:146561842
788+c, tdbSNP:28933970
802+c, tdbSNP:28933972
809+c, gdbSNP:28933971
865+c, tdbSNP:121917720
877+a, gdbSNP:104894469
882+c, tdbSNP:200418409
918+c, tdbSNP:200688741
936+c, tdbSNP:372642425
985+a, tdbSNP:104894468
997+a, gdbSNP:28933373
1063+c, gdbSNP:375546483
1066+a, tdbSNP:104894467
1154+a, gdbSNP:139008563
1166+a, gdbSNP:369478673
1185+c, gdbSNP:201901512
1237+a, gdbSNP:143020311
1242+a, gdbSNP:61734510
1250+c, tdbSNP:370909756
1257+c, tdbSNP:373446060
1261+g, tdbSNP:376393242
1280+c, gdbSNP:370477014
1281+a, gdbSNP:373560196
1295+a, gdbSNP:368669343
1310+c, tdbSNP:371143144
1335+c, tdbSNP:61754301
1340+g, tdbSNP:374534090
1349+c, gdbSNP:116676854
1366+dbSNP:
1366+a, gdbSNP:375436662
1405+a, cdbSNP:199777734
1410+a, gdbSNP:144333747
1415+a, gdbSNP:368787836
1419+c, tdbSNP:374572267
1423+c, tdbSNP:200733091
1443+c, tdbSNP:12881240
1444+c, gdbSNP:4904210
1476+g, tdbSNP:200344655
1501+dbSNP:
1501+c, tdbSNP:145974094
1585+a, gdbSNP:201709294
1656+c, gdbSNP:116602527
1675+a, tdbSNP:139883801
1679+c, tdbSNP:372101496
1749+a, cdbSNP:12887746
1764+g, tdbSNP:188638197
1790+c, tdbSNP:367709886
1812+c, tdbSNP:181408965
1948+c, gdbSNP:186877662
1958+c, tdbSNP:17104962
2011+c, tdbSNP:17104965
2012+c, gdbSNP:112616603
2181+c, tdbSNP:17766200
2258+a, gdbSNP:191674536
2271+g, tdbSNP:113372817
2306+c, gdbSNP:72679753
2392+g, tdbSNP:372490483
2542+c, tdbSNP:141899486
2570+c, tdbSNP:11847165
2600+a, gdbSNP:113144849
2653+c, tdbSNP:17104971
2710+a, tdbSNP:369476667
2818+a, cdbSNP:200113610
2844+, cdbSNP:201941449
3020+a, tdbSNP:114801240
3034+a, cdbSNP:373205266
Gene SymbolPAX9
Gene SynonymSTHAG3
Chromosome14
Locus Map14q13.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006194 Homo sapiens paired box 9 (PAX9), mRNA. On-demand $219.00 7-9
NM_006194 Homo sapiens paired box 9 (PAX9), mRNA. On-demand $219.00 7-9
Title SNPs and interaction analyses of IRF6, MSX1 and PAX9 genes in patients with nonsyndromic cleft lip with or without palate .
Author Song T, Wu D, Wang Y, Li H, Yin N and Zhao Z.
Journal Mol Med Rep 8 (4), 1228-1234 (2013)
Title Large-scale genotyping identifies 41 new loci associated with breast cancer risk .
Author Michailidou K, Hall P, Gonzalez-Neira A, Ghoussaini M, Dennis J, Milne RL, Schmidt MK, Chang-Claude J, Bojesen SE, Bolla MK, Wang Q, Dicks E, Lee A, Turnbull C, Rahman N, Fletcher O, Peto J, Gibson L, Dos Santos Silva I, Nevanlinna H, Muranen TA, Aittomaki K, Blomqvist C, Czene K, Irwanto A, Liu J, Waisfisz Q, Meijers-Heijboer H, Adank M, van der Luijt RB, Hein R, Dahmen N, Beckman L, Meindl A, Schmutzler RK, Muller-Myhsok B, Lichtner P, Hopper JL, Southey MC, Makalic E, Schmidt DF, Uitterlinden AG, Hofman A, Hunter DJ, Chanock SJ, Vincent D, Bacot F, Tessier DC, Canisius S, Wessels LF, Haiman CA, Shah M, Luben R, Brown J, Luccarini C, Schoof N, Humphreys K, Li J, Nordestgaard BG, Nielsen SF, Flyger H, Couch FJ, Wang X, Vachon C, Stevens KN, Lambrechts D, Moisse M, Paridaens R, Christiaens MR, Rudolph A, Nickels S, Flesch-Janys D, Johnson N, Aitken Z, Aaltonen K, Heikkinen T, Broeks A, Veer LJ, van der Schoot CE, Guenel P, Truong T, Laurent-Puig P, Menegaux F, Marme F, Schneeweiss A, Sohn C, Burwinkel B, Zamora MP, Perez JI, Pita G, Alonso MR, Cox A, Brock IW, Cross SS, Reed MW, Sawyer EJ, Tomlinson I, Kerin MJ, Miller N, Henderson BE, Schumacher F, Le Marchand L, Andrulis IL, Knight JA, Glendon G, Mulligan AM, Lindblom A, Margolin S, Hooning MJ, Hollestelle A, van den Ouweland AM, Jager A, Bui QM, Stone J, Dite GS, Apicella C, Tsimiklis H, Giles GG, Severi G, Baglietto L, Fasching PA, Haeberle L, Ekici AB, Beckmann MW, Brenner H, Muller H, Arndt V, Stegmaier C, Swerdlow A, Ashworth A, Orr N, Jones M, Figueroa J, Lissowska J, Brinton L, Goldberg MS, Labreche F, Dumont M, Winqvist R, Pylkas K, Jukkola-Vuorinen A, Grip M, Brauch H, Hamann U, Bruning T, Radice P, Peterlongo P, Manoukian S, Bonanni B, Devilee P, Tollenaar RA, Seynaeve C, van Asperen CJ, Jakubowska A, Lubinski J, Jaworska K, Durda K, Mannermaa A, Kataja V, Kosma VM, Hartikainen JM, Bogdanova NV, Antonenkova NN, Dork T, Kristensen VN, Anton-Culver H, Slager S, Toland AE, Edge S, Fostira F, Kang D, Yoo KY, Noh DY, Matsuo K, Ito H, Iwata H, Sueta A, Wu AH, Tseng CC, Van Den Berg D, Stram DO, Shu XO, Lu W, Gao YT, Cai H, Teo SH, Yip CH, Phuah SY, Cornes BK, Hartman M, Miao H, Lim WY, Sng JH, Muir K, Lophatananon A, Stewart-Brown S, Siriwanarangsan P, Shen CY, Hsiung CN, Wu PE, Ding SL, Sangrajrang S, Gaborieau V, Brennan P, McKay J, Blot WJ, Signorello LB, Cai Q, Zheng W, Deming-Halverson S, Shrubsole M, Long J, Simard J, Garcia-Closas M, Pharoah PD, Chenevix-Trench G, Dunning AM, Benitez J and Easton DF.
Journal Nat. Genet. 45 (4), 353-361 (2013)
Title PAX9 polymorphism and susceptibility to sporadic non-syndromic severe anodontia: a case-control study in southwest China .
Author Wang J, Xu Y, Chen J, Wang F, Huang R, Wu S, Shu L, Qiu J, Yang Z, Xue J, Wang R, Zhao J and Lai W.
Journal J Appl Oral Sci 21 (3), 256-264 (2013)
Title Association between PAX9 single-nucleotide polymorphisms and nonsyndromic cleft lip with or without cleft palate .
Author Lee JK, Park JW, Kim YH and Baek SH.
Journal J Craniofac Surg 23 (5), 1262-1266 (2012)
Title Novel PAX9 and COL1A2 missense mutations causing tooth agenesis and OI/DGI without skeletal abnormalities .
Author Wang SK, Chan HC, Makovey I, Simmer JP and Hu JC.
Journal PLoS ONE 7 (12), E51533 (2012)
Title The novel polymorphic variants within the paired box of the PAX9 gene are associated with selective tooth agenesis .
Author Kobielak A, Kobielak K, Wisniewski AS, Mostowska A, Biedziak B and Trzeciak WH.
Journal Folia Histochem. Cytobiol. 39 (2), 111-112 (2001)
Title Evolutionary conservation of gene structures of the Pax1/9 gene family .
Author Hetzer-Egger C, Schorpp M and Boehm T.
Journal Biochim. Biophys. Acta 1492 (2-3), 517-521 (2000)
Title Mutation of PAX9 is associated with oligodontia .
Author Stockton DW, Das P, Goldenberg M, D'Souza RN and Patel PI.
Journal Nat. Genet. 24 (1), 18-19 (2000)
Title Isolation of the Pax9 cDNA from adult human esophagus .
Author Peters H, Schuster G, Neubuser A, Richter T, Hofler H and Balling R.
Journal Mamm. Genome 8 (1), 62-64 (1997)
Title Chromosomal localization of seven PAX genes and cloning of a novel family member, PAX-9 .
Author Stapleton P, Weith A, Urbanek P, Kozmik Z and Busslinger M.
Journal Nat. Genet. 3 (4), 292-298 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.