• THAT   AND
  • THAT   AND


Homo sapiens prepronociceptin (PNOC), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_006228 Homo sapiens prepronociceptin (PNOC), mRNA. Full Lenth $361.05
ORF Sequence $159.00
RefSeq Version NM_006228.3, 93004096
Length 1245 bp
Structure linear
Update Date 12-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens prepronociceptin (PNOC), mRNA.
Product nociceptin precursor
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from U48263.1, DA403369.1 and BC034758.1. On Apr 20, 2006 this sequence version replaced gi:11079650.

RefSeq NP_006219.1
CDS 209..739
Exon (1)1..185
Exon (2)1..185
Exon (3)186..334
Exon (4)335..786
Exon (5)787..1196
Translation MKVLLCDLLLLSLFSSVFSSCQRDCLTCQEKLHPALDSFDLEVCILECEEKVFPSPLWTP CTKVMARSSWQLSPAAPEHVAAALYQPRASEMQHLRRMPRVRSLFQEQEEPEPGMEEAGE MEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
539..786+, largedeletiondbSNP:71980796
561+c, gdbSNP:76786693
584+c, tdbSNP:112673338
690+c, tdbSNP:111932798
822+a, cdbSNP:13931
946+c, tdbSNP:8192510
1013+a, gdbSNP:17058993
1052+c, tdbSNP:1051617
1059+c, gdbSNP:113667304
Gene SymbolPNOC
Gene SynonymPPNOC
Chromosome8
Locus Map8p21
All Transcripts NM_006228
Title Analysis of the expression profile of CRH-POMC system genes in vitiligo skin biopsies .
Author Reimann,E., Kingo,K., Karelson,M., Salum,T., Aunin,E., Reemann,P., Abram,K., Vasar,E., Silm,H. and Koks,S.
Journal J. Dermatol. Sci. 60 (2), 125-128 (2010)
Title Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score .
Author Rose,J.E., Behm,F.M., Drgon,T., Johnson,C. and Uhl,G.R.
Journal Mol. Med. 16 (7-8), 247-253 (2010)
Title Plasma nociceptin/orphanin FQ levels in response to the hyperventilation test in healthy subjects .
Author Fontana,F., Pizzi,C., Bernardi,P., Pich,E.M., Bedini,A. and Spampinato,S.
Journal Peptides 31 (4), 720-722 (2010)
Title Temporal lobe epilepsy causes selective changes in mu opioid and nociceptin receptor binding and functional coupling to G-proteins in human temporal neocortex .
Author Rocha,L., Orozco-Suarez,S., Alonso-Vanegas,M., Villeda-Hernandez,J., Gaona,A., Paldy,E., Benyhe,S. and Borsodi,A.
Journal Neurobiol. Dis. 35 (3), 466-473 (2009)
Title Genetical genomic determinants of alcohol consumption in rats and humans .
Author Tabakoff,B., Saba,L., Printz,M., Flodman,P., Hodgkinson,C., Goldman,D., Koob,G., Richardson,H.N., Kechris,K., Bell,R.L., Hubner,N., Heinig,M., Pravenec,M., Mangion,J., Legault,L., Dongier,M., Conigrave,K.M., Whitfield,J.B., Saunders,J., Grant,B. and Hoffman,P.L.
Journal BMC Biol. 7, 70 (2009)
Title Nocistatin, a peptide that blocks nociceptin action in pain transmission .
Author Okuda-Ashitaka,E., Minami,T., Tachibana,S., Yoshihara,Y., Nishiuchi,Y., Kimura,T. and Ito,S.
Journal Nature 392 (6673), 286-289 (1998)
Title [Cloning of prepronociceptin has led to the discovery of other biologically active peptides] .
Author Costentin,J., Florin,S., Suaudeau,C. and Meunier,J.C.
Journal C. R. Seances Soc. Biol. Fil. 192 (6), 1099-1109 (1998)
Title Solution conformation of nociceptin .
Author Salvadori,S., Picone,D., Tancredi,T., Guerrini,R., Spadaccini,R., Lazarus,L.H., Regoli,D. and Temussi,P.A.
Journal Biochem. Biophys. Res. Commun. 233 (3), 640-643 (1997)
Title Primary structure and tissue distribution of the orphanin FQ precursor .
Author Nothacker,H.P., Reinscheid,R.K., Mansour,A., Henningsen,R.A., Ardati,A., Monsma,F.J. Jr., Watson,S.J. and Civelli,O.
Journal Proc. Natl. Acad. Sci. U.S.A. 93 (16), 8677-8682 (1996)
Title Structure, tissue distribution, and chromosomal localization of the prepronociceptin gene .
Author Mollereau,C., Simons,M.J., Soularue,P., Liners,F., Vassart,G., Meunier,J.C. and Parmentier,M.
Journal Proc. Natl. Acad. Sci. U.S.A. 93 (16), 8666-8670 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878