• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens polymerase (DNA directed), epsilon, catalytic subunit (POLE), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_006231 Homo sapiens polymerase (DNA directed), epsilon, catalytic subunit (POLE), mRNA. GenEZ ORF Cloning On-demand $3749.00 35

*Business Day

Related Services

RefSeq Version NM_006231.2, 62198236
Length 7859 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens polymerase (DNA directed), epsilon, catalytic subunit (POLE), mRNA.
Product DNA polymerase epsilon catalytic subunit A
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from L09561.1, S60080.1 and BC011376.1. On Apr 5, 2005 this sequence version replaced gi:5453925.

RefSeq NP_006222.2
CDS 45..6905
Misc Feature(1)711..1322
Misc Feature(2)711..1322
Misc Feature(3)846..1457
Misc Feature(4)order(867..878,1128..1133,1140..1148,1311..1316,
Misc Feature(5)order(867..869,873..875,1146..1148,1416..1418,1428..1430)
Misc Feature(6)order(870..878,1128..1133,1140..1145,1311..1316,
Misc Feature(7)1635..3503
Misc Feature(8)order(1920..1922,1929..1937,2328..2330,2469..2471,
Misc Feature(9)<2259..3539
Misc Feature(10)order(2622..2624,2628..2633)
Misc Feature(11)3594..3596
Misc Feature(12)4617..5819
Misc Feature(13)5862..5864
Misc Feature(14)5862..5864
Misc Feature(15)6705..6758
Exon (1)1..106
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (2)107..248
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (3)249..329
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (4)330..374
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (5)375..467
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (6)468..622
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (7)623..764
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (8)765..845
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (9)846..953
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (10)954..1064
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (11)1065..1150
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (12)1151..1270
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (13)1271..1403
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (14)1404..1517
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (15)1518..1730
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (16)1731..1838
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (17)1839..1967
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (18)1968..2070
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (19)2071..2217
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (20)2218..2363
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (21)2364..2512
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (22)2513..2605
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (23)2606..2750
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (24)2751..2908
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (25)2909..3104
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (26)3105..3319
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (27)3320..3422
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (28)3423..3503
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (29)3504..3626
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (30)3627..3839
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (31)3840..4049
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (32)4050..4193
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (33)4194..4334
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (34)4335..4488
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (35)4489..4595
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (36)4596..4772
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (37)4773..4996
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (38)4997..5217
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (39)5218..5422
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (40)5423..5596
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (41)5597..5722
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (42)5723..5855
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (43)5856..6048
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (44)6049..6180
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (45)6181..6374
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (46)6375..6575
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (47)6576..6701
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (48)6702..6791
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (49)6792..7840
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Translation MSLRSGGRRRADPGADGEASRDDGATSSVSALKRLERSQWTDKMDLRFGFERLKEPGEKT GWLINMHPTEILDEDKRLGSAVDYYFIQDDGSRFKVALPYKPYFYIATRKGCEREVSSFL SKKFQGKIAKVETVPKEDLDLPNHLVGLKRNYIRLSFHTVEDLVKVRKEISPAVKKNREQ DHASDAYTALLSSVLQRGGVITDEEETSKKIADQLDNIVDMREYDVPYHIRLSIDLKIHV AHWYNVRYRGNAFPVEITRRDDLVERPDPVVLAFDIETTKLPLKFPDAETDQIMMISYMI DGQGYLITNREIVSEDIEDFEFTPKPEYEGPFCVFNEPDEAHLIQRWFEHVQETKPTIMV TYNGDFFDWPFVEARAAVHGLSMQQEIGFQKDSQGEYKAPQCIHMDCLRWVKRDSYLPVG SHNLKAAAKAKLGYDPVELDPEDMCRMATEQPQTLATYSVSDAVATYYLYMKYVHPFIFA LCTIIPMEPDEVLRKGSGTLCEALLMVQAFHANIIFPNKQEQEFNKLTDDGHVLDSETYV GGHVEALESGVFRSDIPCRFRMNPAAFDFLLQRVEKTLRHALEEEEKVPVEQVTNFEEVC DEIKSKLASLKDVPSRIECPLIYHLDVGAMYPNIILTNRLQPSAMVDEATCAACDFNKPG ANCQRKMAWQWRGEFMPASRSEYHRIQHQLESEKFPPLFPEGPARAFHELSREEQAKYEK RRLADYCRKAYKKIHITKVEERLTTICQRENSFYVDTVRAFRDRRYEFKGLHKVWKKKLS AAVEVGDAAEVKRCKNMEVLYDSLQLAHKCILNSFYGYVMRKGARWYSMEMAGIVCFTGA NIITQARELIEQIGRPLELDTDGIWCVLPNSFPENFVFKTTNVKKPKVTISYPGAMLNIM VKEGFTNDQYQELAEPSSLTYVTRSENSIFFEVDGPYLAMILPASKEEGKKLKKRYAVFN EDGSLAELKGFEVKRRGELQLIKIFQSSVFEAFLKGSTLEEVYGSVAKVADYWLDVLYSK AANMPDSELFELISENRSMSRKLEDYGEQKSTSISTAKRLAEFLGDQMVKDAGLSCRYII SRKPEGSPVTERAIPLAIFQAEPTVRKHFLRKWLKSSSLQDFDIRAILDWDYYIERLGSA IQKIITIPAALQQVKNPVPRVKHPDWLHKKLLEKNDVYKQKKISELFTLEGRRQVTMAEA SEDSPRPSAPDMEDFGLVKLPHPAAPVTVKRKRVLWESQEESQDLTPTVPWQEILGQPPA LGTSQEEWLVWLRFHKKKWQLQARQRLARRKRQRLESAEGVLRPGAIRDGPATGLGSFLR RTARSILDLPWQIVQISETSQAGLFRLWALVGSDLHCIRLSIPRVFYVNQRVAKAEEGAS YRKVNRVLPRSNMVYNLYEYSVPEDMYQEHINEINAELSAPDIEGVYETQVPLLFRALVH LGCVCVVNKQLVRHLSGWEAETFALEHLEMRSLAQFSYLEPGSIRHIYLYHHAQAHKALF GIFIPSQRRASVFVLDTVRSNQMPSLGALYSAEHGLLLEKVGPELLPPPKHTFEVRAETD LKTICRAIQRFLLAYKEERRGPTLIAVQSSWELKRLASEIPVLEEFPLVPICVADKINYG VLDWQRHGARRMIRHYLNLDTCLSQAFEMSRYFHIPIGNLPEDISTFGSDLFFARHLQRH NHLLWLSPTARPDLGGKEADDNCLVMEFDDQATVEINSSGCYSTVCVELDLQNLAVNTIL QSHHVNDMEGADSMGISFDVIQQASLEDMITGGQAASAPASYDETALCSNTFRILKSMVV GWVKEITQYHNIYADNQVMHFYRWLRSPSSLLHDPALHRTLHNMMKKLFLQLIAEFKRLG SSVIYANFNRIILCTKKRRVEDAIAYVEYITSSIHSKETFHSLTISFSRCWEFLLWMDPS NYGGIKGKVSSRIHCGLQDSQKAGGAEDEQENEDDEEERDGEEEEEAEESNVEDLLENNW NILQFLPQAASCQNYFLMIVSAYIVAVYHCMKDGLRRSAPGSTPVRRRGASQLSQEAEGA VGALPGMITFSQDYVANELTQSFFTITQKIQKKVTGSRNSTELSEMFPVLPGSHLLLNNP ALEFIKYVCKVLSLDTNITNQVNKLNRDLLRLVDVGEFSEEAQFRDPCRSYVLPEVICRS CNFCRDLDLCKDSSFSEDGAVLPQWLCSNCQAPYDSSAIEMTLVEVLQKKLMAFTLQDLV CLKCRGVKETSMPVYCSCAGDFALTIHTQVFMEQIGIFRNIAQHYGMSYLLETLEWLLQK NPQLGH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(60)-g, cdbSNP:202220778
complement(116)-dbSNP:
complement(116)-g, adbSNP:61751359
complement(120)-t, cdbSNP:182282150
complement(135)-c, adbSNP:34047482
complement(157)-t, cdbSNP:141424313
complement(166)-g, adbSNP:148269473
complement(167)-g, adbSNP:5744734
complement(182)-g, cdbSNP:200611521
complement(183)-g, adbSNP:143626223
complement(198)-g, adbSNP:115452881
complement(206)-t, cdbSNP:112796325
complement(251)-dbSNP:
complement(251)-g, cdbSNP:146986360
complement(290)-t, cdbSNP:61751358
complement(296)-g, adbSNP:148838481
complement(340)-dbSNP:
complement(340)-t, cdbSNP:5744739
complement(343)-t, adbSNP:201279820
complement(395)-dbSNP:
complement(395)-t, cdbSNP:199773841
complement(443)-g, adbSNP:202102690
complement(487)-dbSNP:
complement(487)-t, adbSNP:12315832
complement(520)-g, adbSNP:150083426
complement(563)-g, adbSNP:187690610
complement(590)-g, adbSNP:115257501
complement(601)-g, adbSNP:151325267
complement(605)-g, adbSNP:143938822
complement(638)-dbSNP:
complement(638)-g, adbSNP:140185156
complement(735)-g, adbSNP:146592584
complement(767)-dbSNP:
complement(767)-t, adbSNP:144422646
complement(768)-g, adbSNP:148525573
complement(799)-t, cdbSNP:5744751
complement(805)-g, adbSNP:200211438
complement(818)-g, cdbSNP:149345392
complement(820)-t, cdbSNP:61732929
complement(823)-g, adbSNP:5744752
complement(830)-g, adbSNP:201223598
complement(841)-c, adbSNP:115786159
complement(883)-dbSNP:
complement(883)-t, cdbSNP:143690372
complement(888)-g, adbSNP:138207610
complement(890)-t, cdbSNP:5744758
complement(905)-t, adbSNP:139075637
complement(999)-dbSNP:
complement(999)-t, cdbSNP:116162724
complement(1051)-g, adbSNP:5744760
complement(1058)-g, adbSNP:143102561
complement(1059)-t, cdbSNP:149029910
complement(1065)-dbSNP:
complement(1065)-c, adbSNP:137860861
complement(1091)-t, cdbSNP:200661323
complement(1106)-g, cdbSNP:145245295
complement(1108)-t, cdbSNP:141396559
complement(1125)-t, gdbSNP:201315364
complement(1133)-g, adbSNP:146639652
complement(1182)-dbSNP:
complement(1182)-t, cdbSNP:199746481
complement(1326)-dbSNP:
complement(1326)-t, cdbSNP:150032060
complement(1332)-t, cdbSNP:140566004
complement(1340)-t, cdbSNP:142624113
complement(1353)-c, adbSNP:115047349
complement(1367)-t, cdbSNP:116573514
complement(1380)-g, adbSNP:200403177
complement(1381)-t, cdbSNP:151273553
complement(1391)-t, cdbSNP:142373951
complement(1514)-dbSNP:
complement(1514)-t, cdbSNP:5744777
complement(1525)-dbSNP:
complement(1525)-t, cdbSNP:192173820
complement(1529)-t, cdbSNP:116062148
complement(1578)-t, cdbSNP:113998091
complement(1581)-t, cdbSNP:200136603
complement(1604)-t, cdbSNP:201841065
complement(1617)-t, gdbSNP:147233527
complement(1618)-t, cdbSNP:74878897
complement(1627)-g, adbSNP:116263919
complement(1640)-g, adbSNP:114978673
complement(1689)-g, adbSNP:115558715
complement(1702)-t, cdbSNP:145370369
complement(1739)-dbSNP:
complement(1739)-t, gdbSNP:139748472
complement(1746)-t, cdbSNP:115340410
complement(1751)-g, adbSNP:147438050
complement(1779)-g, adbSNP:116260568
complement(1780)-t, cdbSNP:149296223
complement(1784)-g, adbSNP:114972594
complement(1824)-t, cdbSNP:138610926
complement(1880)-dbSNP:
complement(1880)-g, adbSNP:116456858
complement(1881)-t, cdbSNP:200471266
complement(1912)-t, cdbSNP:150564856
complement(1941)-t, cdbSNP:141657198
complement(1944)-t, cdbSNP:137947539
complement(1949)-g, adbSNP:145203544
complement(1993)-dbSNP:
complement(1993)-g, adbSNP:115559742
complement(2017)-t, adbSNP:199890659
complement(2077)-dbSNP:
complement(2077)-g, adbSNP:116719126
complement(2097)-g, adbSNP:116326665
complement(2102)-t, gdbSNP:140254249
complement(2127)-t, adbSNP:5744799
complement(2133)-t, cdbSNP:5744800
complement(2134)-g, cdbSNP:36120395
complement(2142)-g, adbSNP:145793634
complement(2150)-t, gdbSNP:5744801
complement(2157)-g, adbSNP:200621883
complement(2174)-c, adbSNP:77327458
complement(2179)-t, cdbSNP:115225325
complement(2192)-t, cdbSNP:115142739
complement(2205)-t, cdbSNP:142405043
complement(2215)-g, adbSNP:61734163
complement(2269)-dbSNP:
complement(2269)-t, cdbSNP:116360781
complement(2306)-g, adbSNP:145337550
complement(2337)-g, adbSNP:200825008
complement(2384)-dbSNP:
complement(2384)-g, adbSNP:5744822
complement(2387)-t, cdbSNP:199751241
complement(2390)-g, adbSNP:114642756
complement(2394)-t, cdbSNP:147427999
complement(2423)-g, adbSNP:200259552
complement(2433)-t, cdbSNP:142196181
complement(2455)-c, adbSNP:201668507
complement(2497)-t, cdbSNP:148691442
complement(2509)-t, cdbSNP:144007794
complement(2517)-dbSNP:
complement(2517)-g, adbSNP:200283666
complement(2525)-g, adbSNP:149513974
complement(2554)-g, adbSNP:139182500
complement(2594)-t, cdbSNP:5744834
complement(2604)-t, cdbSNP:200179156
complement(2646)-dbSNP:
complement(2646)-g, adbSNP:115830215
complement(2682)-t, cdbSNP:138548494
complement(2727)-t, cdbSNP:201115064
complement(2742)-t, cdbSNP:150091117
complement(2817)-dbSNP:
complement(2817)-g, adbSNP:141552148
complement(2862)-t, cdbSNP:148382941
complement(2965)-dbSNP:
complement(2965)-t, cdbSNP:201333356
complement(2972)-t, cdbSNP:5744845
complement(2973)-t, cdbSNP:142563997
complement(2979)-g, adbSNP:56081968
complement(3007)-g, adbSNP:138391248
complement(3008)-t, cdbSNP:200080353
complement(3018)-t, cdbSNP:115193764
complement(3090)-t, cdbSNP:147692158
complement(3098)-g, adbSNP:201249963
complement(3140)-dbSNP:
complement(3140)-g, adbSNP:200122629
complement(3170)-g, adbSNP:5744856
complement(3200)-g, adbSNP:5744857
complement(3267)-t, adbSNP:145680387
complement(3273)-g, adbSNP:149777592
complement(3289)-t, cdbSNP:201744227
complement(3376)-dbSNP:
complement(3376)-c, adbSNP:114315196
complement(3377)-t, cdbSNP:200319525
complement(3390)-t, cdbSNP:184116505
complement(3417)-g, adbSNP:139603739
complement(3452)-dbSNP:
complement(3452)-c, adbSNP:151018745
complement(3533)-dbSNP:
complement(3533)-t, cdbSNP:5744888
complement(3601)-g, adbSNP:112099123
complement(3638)-dbSNP:
complement(3638)-g, adbSNP:200803943
complement(3664)-g, adbSNP:144086049
complement(3690)-t, cdbSNP:200114024
complement(3722)-g, adbSNP:139354109
complement(3742)-t, cdbSNP:201738371
complement(3760)-t, cdbSNP:146210785
complement(3762)-t, cdbSNP:113594027
complement(3791)-t, cdbSNP:80290414
complement(3822)-t, cdbSNP:143858927
complement(3852)-dbSNP:
complement(3852)-c, adbSNP:199574832
complement(3893)-g, adbSNP:201848987
complement(3895)-t, cdbSNP:149462407
complement(3906)-t, cdbSNP:200398117
complement(3925)-t, cdbSNP:115455318
complement(3945)-t, cdbSNP:112098447
complement(3956)-g, adbSNP:116482376
complement(3983)-t, cdbSNP:150282789
complement(4015)-t, cdbSNP:143981093
complement(4091)-dbSNP:
complement(4091)-t, cdbSNP:201746181
complement(4095)-t, cdbSNP:138443282
complement(4099)-g, cdbSNP:147088333
complement(4101)-t, cdbSNP:141619382
complement(4155)-g, adbSNP:151278283
complement(4184)-t, cdbSNP:199851128
complement(4188)-t, cdbSNP:5744904
complement(4189)-t, cdbSNP:143229302
complement(4213)-dbSNP:
complement(4213)-t, cdbSNP:200776293
complement(4216)-g, cdbSNP:149145495
complement(4228)-g, adbSNP:5744933
complement(4231)-g, adbSNP:5744934
complement(4239)-g, cdbSNP:5744935
complement(4242)-t, adbSNP:139420451
complement(4290)-t, cdbSNP:146711942
complement(4303)-t, cdbSNP:41561818
complement(4311)-t, cdbSNP:139498590
complement(4387)-dbSNP:
complement(4387)-t, cdbSNP:150545516
complement(4406)-g, adbSNP:115568973
complement(4445)-g, adbSNP:145477920
complement(4446)-g, adbSNP:139970867
complement(4456)-t, cdbSNP:113809231
complement(4500)-dbSNP:
complement(4500)-t, gdbSNP:201733230
complement(4520)-t, cdbSNP:5744943
complement(4567)-t, cdbSNP:142508245
complement(4574)-g, adbSNP:5744944
complement(4578)-t, cdbSNP:147354120
complement(4585)-g, adbSNP:116742454
complement(4603)-dbSNP:
complement(4603)-g, cdbSNP:144045570
complement(4647)-t, cdbSNP:138564205
complement(4649)-g, cdbSNP:75930376
complement(4679)-g, adbSNP:199945393
complement(4689)-g, cdbSNP:147500308
complement(4693)-g, adbSNP:5744947
complement(4704)-t, cdbSNP:143247306
complement(4760)-t, cdbSNP:138782478
complement(4763)-g, adbSNP:115219846
complement(4774)-dbSNP:
complement(4774)-c, adbSNP:5744948
complement(4782)-g, adbSNP:192908615
complement(4783)-t, cdbSNP:201950040
complement(4819)-t, cdbSNP:115873219
complement(4834)-g, cdbSNP:75228172
complement(4845)-g, adbSNP:147467247
complement(4853)-c, adbSNP:75378940
complement(4932)-g, adbSNP:148076304
complement(4985)-g, adbSNP:145639967
complement(5045)-dbSNP:
complement(5045)-g, adbSNP:112358554
complement(5051)-g, adbSNP:146761597
complement(5108)-t, adbSNP:56102033
complement(5150)-g, adbSNP:116001373
complement(5168)-g, adbSNP:114891564
complement(5179)-t, cdbSNP:5744950
complement(5184)-c, adbSNP:144941152
complement(5267)-dbSNP:
complement(5267)-c, adbSNP:184039394
complement(5282)-g, adbSNP:200128464
complement(5309)-t, cdbSNP:201967886
complement(5311)-t, adbSNP:199535980
complement(5357)-t, cdbSNP:201803493
complement(5378)-g, adbSNP:11146986
complement(5391)-t, cdbSNP:149893630
complement(5395)-t, cdbSNP:139093285
complement(5408)-t, cdbSNP:5744955
complement(5442)-dbSNP:
complement(5442)-t, cdbSNP:199777048
complement(5456)-t, cdbSNP:144218410
complement(5496)-t, cdbSNP:140174561
complement(5540)-g, adbSNP:147543146
complement(5559)-g, adbSNP:141519273
complement(5586)-g, adbSNP:201001790
complement(5595)-g, adbSNP:185498408
complement(5614)-dbSNP:
complement(5614)-g, adbSNP:5744971
complement(5619)-g, cdbSNP:184253572
complement(5622)-g, cdbSNP:144343630
complement(5627)-c, adbSNP:5744972
complement(5652)-g, adbSNP:138231414
complement(5676)-g, adbSNP:199979862
complement(5680)-t, cdbSNP:145621558
complement(5703)-t, cdbSNP:114119067
complement(5711)-g, adbSNP:201962689
complement(5719)-g, cdbSNP:114173192
complement(5751)-dbSNP:
complement(5751)-t, cdbSNP:5744990
complement(5770)-t, cdbSNP:201455049
complement(5807)-t, g, adbSNP:113976595
complement(5848)-g, adbSNP:5744991
complement(5944)-dbSNP:
complement(5944)-g, adbSNP:201273415
complement(5945)-t, cdbSNP:200474862
complement(5961)-c, adbSNP:7487595
complement(6050)-dbSNP:
complement(6050)-t, cdbSNP:146902214
complement(6054)-t, cdbSNP:148841335
complement(6056)-g, adbSNP:147806951
complement(6062)-g, adbSNP:111709550
complement(6093)-g, adbSNP:115452769
complement(6094)-t, cdbSNP:144178150
complement(6097)-t, cdbSNP:140344645
complement(6156)-t, cdbSNP:181570274
complement(6163)-t, cdbSNP:5745021
complement(6168)-t, cdbSNP:147954675
complement(6176..6177)-, adbSNP:35055217
complement(6200)-dbSNP:
complement(6200)-t, cdbSNP:149841283
complement(6210)-t, cdbSNP:58916399
complement(6254)-t, adbSNP:139990705
complement(6296)-g, adbSNP:5745022
complement(6326)-g, adbSNP:113581307
complement(6365)-g, adbSNP:201656807
complement(6395..6396)-dbSNP:
complement(6395..6396)-, tdbSNP:34241316
complement(6424)-t, cdbSNP:199613242
complement(6436)-t, cdbSNP:141954509
complement(6449)-g, adbSNP:139607077
complement(6462)-g, adbSNP:5745066
complement(6490)-t, cdbSNP:201165149
complement(6497)-g, adbSNP:116076060
complement(6498)-t, cdbSNP:138789360
complement(6519)-t, cdbSNP:5745067
complement(6538)-g, adbSNP:5745068
complement(6539)-g, adbSNP:114778730
complement(6552)-g, adbSNP:138094751
complement(6609)-dbSNP:
complement(6609)-t, adbSNP:150345709
complement(6641)-g, adbSNP:147611144
complement(6650)-t, cdbSNP:11146982
complement(6719)-dbSNP:
complement(6719)-g, adbSNP:149973644
complement(6758)-g, adbSNP:200082120
complement(6760)-g, adbSNP:190813054
complement(6807)-dbSNP:
complement(6807)-t, adbSNP:73155056
complement(6810)-t, cdbSNP:116323660
complement(6817)-g, adbSNP:71452531
complement(6839)-g, adbSNP:142222159
complement(6840)-t, cdbSNP:200911338
complement(6861)-t, adbSNP:73481453
complement(6864)-g, cdbSNP:148788180
complement(6875)-c, adbSNP:145427269
complement(6947)-t, gdbSNP:5745083
complement(6949)-g, cdbSNP:113095243
complement(6971)-g, adbSNP:5745084
complement(6995)-t, cdbSNP:79419148
complement(7023)-g, cdbSNP:138980040
complement(7038)-t, cdbSNP:146111596
complement(7149)-g, adbSNP:5745085
complement(7169)-t, cdbSNP:5745086
complement(7182)-t, cdbSNP:183634984
complement(7198)-t, gdbSNP:137911728
complement(7251)-t, cdbSNP:191419597
complement(7296)-, cdbSNP:5801983
complement(7329)-c, adbSNP:186570282
complement(7334)-g, adbSNP:5745087
complement(7401)-c, adbSNP:5745088
complement(7439)-t, cdbSNP:5745089
complement(7440)-t, cdbSNP:14302
complement(7448)-g, adbSNP:5745090
complement(7525)-g, adbSNP:5745091
complement(7691)-t, cdbSNP:11831601
complement(7810..7811)-c, adbSNP:11540669
complement(7811)-c, adbSNP:8435
complement(7818)-t, cdbSNP:5745092
complement(7839)-g, adbSNP:143493422
Gene SymbolPOLE
Gene SynonymCRCS12; FILS; POLE1
Chromosome12
Locus Map12q24.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006231 Homo sapiens polymerase (DNA directed), epsilon, catalytic subunit (POLE), mRNA. On-demand $3749.00 35
Title Germline mutations affecting the proofreading domains of POLE and POLD1 predispose to colorectal adenomas and carcinomas .
Author Palles,C., Cazier,J.B., Howarth,K.M., Domingo,E., Jones,A.M., Broderick,P., Kemp,Z., Spain,S.L., Almeida,E.G., Salguero,I., Sherborne,A., Chubb,D., Carvajal-Carmona,L.G., Ma,Y., Kaur,K., Dobbins,S., Barclay,E., Gorman,M., Martin,L., Kovac,M.B., Humphray,S., Lucassen,A., Holmes,C.C., Bentley,D., Donnelly,P., Taylor,J., Petridis,C., Roylance,R., Sawyer,E.J., Kerr,D.J., Clark,S., Grimes,J., Kearsey,S.E., Thomas,H.J., McVean,G., Houlston,R.S. and Tomlinson,I.
Journal Nat. Genet. 45 (2), 136-144 (2013)
Title Polymerase epsilon1 mutation in a human syndrome with facial dysmorphism, immunodeficiency, livedo, and short stature ('FILS syndrome') .
Author Pachlopnik Schmid,J., Lemoine,R., Nehme,N., Cormier-Daire,V., Revy,P., Debeurme,F., Debre,M., Nitschke,P., Bole-Feysot,C., Legeai-Mallet,L., Lim,A., de Villartay,J.P., Picard,C., Durandy,A., Fischer,A. and de Saint Basile,G.
Journal J. Exp. Med. 209 (13), 2323-2330 (2012)
Title Human DNA polymerase epsilon is able to efficiently extend from multiple consecutive ribonucleotides .
Author Goksenin,A.Y., Zahurancik,W., LeCompte,K.G., Taggart,D.J., Suo,Z. and Pursell,Z.F.
Journal J. Biol. Chem. 287 (51), 42675-42684 (2012)
Title Segregation of replicative DNA polymerases during S phase: DNA polymerase epsilon, but not DNA polymerases alpha/delta, are associated with lamins throughout S phase in human cells .
Author Vaara,M., Itkonen,H., Hillukkala,T., Liu,Z., Nasheuer,H.P., Schaarschmidt,D., Pospiech,H. and Syvaoja,J.E.
Journal J. Biol. Chem. 287 (40), 33327-33338 (2012)
Title Properties of the human Cdc45/Mcm2-7/GINS helicase complex and its action with DNA polymerase epsilon in rolling circle DNA synthesis .
Author Kang,Y.H., Galal,W.C., Farina,A., Tappin,I. and Hurwitz,J.
Journal Proc. Natl. Acad. Sci. U.S.A. 109 (16), 6042-6047 (2012)
Title Human DNA polymerase epsilon: enzymologic mechanism and gap-filling synthesis .
Author Mozzherin,D.J. and Fisher,P.A.
Journal Biochemistry 35 (11), 3572-3577 (1996)
Title Localization of the gene for DNA polymerase epsilon (POLE) to human chromosome 12q24.3 and rat chromosome 12 by somatic cell hybrid panels and fluorescence in situ hybridization .
Author Szpirer,J., Pedeutour,F., Kesti,T., Riviere,M., Syvaoja,J.E., Turc-Carel,C. and Szpirer,C.
Journal Genomics 20 (2), 223-226 (1994)
Title Molecular cloning of the cDNA for the catalytic subunit of human .
Author Kesti,T., Frantti,H. and Syvaoja,J.E.
Journal J. Biol. Chem. 268 (14), 10238-10245 (1993)
Title The function of DNA polymerases in DNA repair synthesis of ultraviolet-irradiated human fibroblasts .
Author Popanda,O. and Thielmann,H.W.
Journal Biochim. Biophys. Acta 1129 (2), 155-160 (1992)
Title DNA primase from KB cells. Characterization of a primase activity tightly associated with immunoaffinity-purified DNA polymerase-alpha .
Author Wang,T.S., Hu,S.Z. and Korn,D.
Journal J. Biol. Chem. 259 (3), 1854-1865 (1984)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.