• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens polymerase (DNA directed), epsilon, catalytic subunit (POLE), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu20900 Homo sapiens polymerase (DNA directed), epsilon, catalytic subunit (POLE), mRNA. pcDNA3.1+-DYK On-demand $3749.00 35
OHu20900C Homo sapiens polymerase (DNA directed), epsilon, catalytic subunit (POLE), mRNA. Customized vector On-demand $3749.00 35

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_006231.3, 545746428
Length 6861 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens polymerase (DNA directed), epsilon, catalytic subunit (POLE), mRNA.
Product DNA polymerase epsilon catalytic subunit A
Comment

Summary: This gene encodes the catalytic subunit of DNA polymerase epsilon. The enzyme is involved in DNA repair and chromosomal DNA replication. Mutations in this gene have been associated with colorectal cancer 12 and facial dysmorphism, immunodeficiency, livedo, and short stature. [provided by RefSeq, Sep 2013].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_006222.2
CDS 210..7070
Misc Feature(1)120..122
Misc Feature(2)504..3704
Misc Feature(3)504..3704
Misc Feature(4)1011..1622
Misc Feature(5)order(1032..1043,1293..1298,1305..1313,1476..1481,
Misc Feature(6)order(1032..1034,1038..1040,1311..1313,1581..1583,
Misc Feature(7)order(1035..1043,1293..1298,1305..1310,1476..1481,
Misc Feature(8)1800..3668
Misc Feature(9)order(2085..2087,2094..2102,2493..2495,2634..2636,
Misc Feature(10)order(2787..2789,2793..2798)
Misc Feature(11)3759..3761
Misc Feature(12)4782..5984
Misc Feature(13)6027..6029
Misc Feature(14)6027..6029
Misc Feature(15)6870..6923
Exon (1)1..271
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (2)272..413
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (3)414..494
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (4)495..539
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (5)540..632
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (6)633..787
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (7)788..929
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (8)930..1010
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (9)1011..1118
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (10)1119..1229
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (11)1230..1315
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (12)1316..1435
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (13)1436..1568
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (14)1569..1682
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (15)1683..1895
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (16)1896..2003
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (17)2004..2132
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (18)2133..2235
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (19)2236..2382
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (20)2383..2528
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (21)2529..2677
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (22)2678..2770
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (23)2771..2915
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (24)2916..3073
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (25)3074..3269
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (26)3270..3484
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (27)3485..3587
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (28)3588..3668
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (29)3669..3791
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (30)3792..4004
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (31)4005..4214
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (32)4215..4358
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (33)4359..4499
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (34)4500..4653
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (35)4654..4760
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (36)4761..4937
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (37)4938..5161
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (38)5162..5382
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (39)5383..5587
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (40)5588..5761
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (41)5762..5887
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (42)5888..6020
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (43)6021..6213
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (44)6214..6345
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (45)6346..6539
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (46)6540..6740
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (47)6741..6866
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (48)6867..6956
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Exon (49)6957..8005
Gene:POLE
Gene Synonym:CRCS12; FILS; POLE1
Translation MSLRSGGRRRADPGADGEASRDDGATSSVSALKRLERSQWTDKMDLRFGFERLKEPGEKT GWLINMHPTEILDEDKRLGSAVDYYFIQDDGSRFKVALPYKPYFYIATRKGCEREVSSFL SKKFQGKIAKVETVPKEDLDLPNHLVGLKRNYIRLSFHTVEDLVKVRKEISPAVKKNREQ DHASDAYTALLSSVLQRGGVITDEEETSKKIADQLDNIVDMREYDVPYHIRLSIDLKIHV AHWYNVRYRGNAFPVEITRRDDLVERPDPVVLAFDIETTKLPLKFPDAETDQIMMISYMI DGQGYLITNREIVSEDIEDFEFTPKPEYEGPFCVFNEPDEAHLIQRWFEHVQETKPTIMV TYNGDFFDWPFVEARAAVHGLSMQQEIGFQKDSQGEYKAPQCIHMDCLRWVKRDSYLPVG SHNLKAAAKAKLGYDPVELDPEDMCRMATEQPQTLATYSVSDAVATYYLYMKYVHPFIFA LCTIIPMEPDEVLRKGSGTLCEALLMVQAFHANIIFPNKQEQEFNKLTDDGHVLDSETYV GGHVEALESGVFRSDIPCRFRMNPAAFDFLLQRVEKTLRHALEEEEKVPVEQVTNFEEVC DEIKSKLASLKDVPSRIECPLIYHLDVGAMYPNIILTNRLQPSAMVDEATCAACDFNKPG ANCQRKMAWQWRGEFMPASRSEYHRIQHQLESEKFPPLFPEGPARAFHELSREEQAKYEK RRLADYCRKAYKKIHITKVEERLTTICQRENSFYVDTVRAFRDRRYEFKGLHKVWKKKLS AAVEVGDAAEVKRCKNMEVLYDSLQLAHKCILNSFYGYVMRKGARWYSMEMAGIVCFTGA NIITQARELIEQIGRPLELDTDGIWCVLPNSFPENFVFKTTNVKKPKVTISYPGAMLNIM VKEGFTNDQYQELAEPSSLTYVTRSENSIFFEVDGPYLAMILPASKEEGKKLKKRYAVFN EDGSLAELKGFEVKRRGELQLIKIFQSSVFEAFLKGSTLEEVYGSVAKVADYWLDVLYSK AANMPDSELFELISENRSMSRKLEDYGEQKSTSISTAKRLAEFLGDQMVKDAGLSCRYII SRKPEGSPVTERAIPLAIFQAEPTVRKHFLRKWLKSSSLQDFDIRAILDWDYYIERLGSA IQKIITIPAALQQVKNPVPRVKHPDWLHKKLLEKNDVYKQKKISELFTLEGRRQVTMAEA SEDSPRPSAPDMEDFGLVKLPHPAAPVTVKRKRVLWESQEESQDLTPTVPWQEILGQPPA LGTSQEEWLVWLRFHKKKWQLQARQRLARRKRQRLESAEGVLRPGAIRDGPATGLGSFLR RTARSILDLPWQIVQISETSQAGLFRLWALVGSDLHCIRLSIPRVFYVNQRVAKAEEGAS YRKVNRVLPRSNMVYNLYEYSVPEDMYQEHINEINAELSAPDIEGVYETQVPLLFRALVH LGCVCVVNKQLVRHLSGWEAETFALEHLEMRSLAQFSYLEPGSIRHIYLYHHAQAHKALF GIFIPSQRRASVFVLDTVRSNQMPSLGALYSAEHGLLLEKVGPELLPPPKHTFEVRAETD LKTICRAIQRFLLAYKEERRGPTLIAVQSSWELKRLASEIPVLEEFPLVPICVADKINYG VLDWQRHGARRMIRHYLNLDTCLSQAFEMSRYFHIPIGNLPEDISTFGSDLFFARHLQRH NHLLWLSPTARPDLGGKEADDNCLVMEFDDQATVEINSSGCYSTVCVELDLQNLAVNTIL QSHHVNDMEGADSMGISFDVIQQASLEDMITGGQAASAPASYDETALCSNTFRILKSMVV GWVKEITQYHNIYADNQVMHFYRWLRSPSSLLHDPALHRTLHNMMKKLFLQLIAEFKRLG SSVIYANFNRIILCTKKRRVEDAIAYVEYITSSIHSKETFHSLTISFSRCWEFLLWMDPS NYGGIKGKVSSRIHCGLQDSQKAGGAEDEQENEDDEEERDGEEEEEAEESNVEDLLENNW NILQFLPQAASCQNYFLMIVSAYIVAVYHCMKDGLRRSAPGSTPVRRRGASQLSQEAEGA VGALPGMITFSQDYVANELTQSFFTITQKIQKKVTGSRNSTELSEMFPVLPGSHLLLNNP ALEFIKYVCKVLSLDTNITNQVNKLNRDLLRLVDVGEFSEEAQFRDPCRSYVLPEVICRS CNFCRDLDLCKDSSFSEDGAVLPQWLCSNCQAPYDSSAIEMTLVEVLQKKLMAFTLQDLV CLKCRGVKETSMPVYCSCAGDFALTIHTQVFMEQIGIFRNIAQHYGMSYLLETLEWLLQK NPQLGH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(33)-dbSNP:
complement(33)-t, gdbSNP:145563305
complement(130)-g, adbSNP:182503537
complement(156)-c, adbSNP:150437472
complement(225)-g, cdbSNP:202220778
complement(281)-dbSNP:
complement(281)-g, adbSNP:61751359
complement(285)-t, cdbSNP:182282150
complement(299)-t, cdbSNP:369224511
complement(300)-c, adbSNP:34047482
complement(315)-g, cdbSNP:370268888
complement(319)-t, cdbSNP:377002290
complement(322)-t, cdbSNP:141424313
complement(331)-g, adbSNP:148269473
complement(332)-g, adbSNP:5744734
complement(347)-g, cdbSNP:200611521
complement(348)-g, adbSNP:143626223
complement(363)-g, adbSNP:115452881
complement(364)-t, cdbSNP:372459649
complement(371)-t, cdbSNP:112796325
complement(416)-dbSNP:
complement(416)-g, cdbSNP:146986360
complement(444)-t, cdbSNP:376927142
complement(455)-t, cdbSNP:61751358
complement(458)-g, adbSNP:374225370
complement(461)-g, adbSNP:148838481
complement(481)-t, cdbSNP:376348304
complement(505)-dbSNP:
complement(505)-t, cdbSNP:5744739
complement(505)-g, adbSNP:386599695
complement(508)-t, adbSNP:201279820
complement(550)-dbSNP:
complement(550)-t, cdbSNP:375785166
complement(559)-g, adbSNP:372057971
complement(560)-t, cdbSNP:199773841
complement(587)-t, gdbSNP:374163231
complement(608)-g, adbSNP:202102690
complement(649)-dbSNP:
complement(649)-t, cdbSNP:377573501
complement(652)-t, adbSNP:12315832
complement(655)-t, cdbSNP:374428362
complement(668)-g, cdbSNP:371147799
complement(685)-g, adbSNP:150083426
complement(686)-g, adbSNP:377652373
complement(719)-t, gdbSNP:374074035
complement(728)-g, adbSNP:187690610
complement(755)-g, adbSNP:115257501
complement(762)-t, cdbSNP:369506007
complement(765)-t, cdbSNP:375213599
complement(766)-g, adbSNP:151325267
complement(770)-g, adbSNP:143938822
complement(803)-dbSNP:
complement(803)-g, adbSNP:140185156
complement(811)-g, adbSNP:375209004
complement(881)-g, adbSNP:376923206
complement(900)-g, adbSNP:146592584
complement(927)-t, cdbSNP:371882716
complement(932)-dbSNP:
complement(932)-t, adbSNP:144422646
complement(933)-g, adbSNP:148525573
964+c, tdbSNP:5744751
complement(964)-g, adbSNP:386599698
complement(970)-g, adbSNP:200211438
complement(971)-t, cdbSNP:371334601
complement(983)-g, cdbSNP:149345392
complement(985)-t, cdbSNP:61732929
988+a, gdbSNP:5744752
complement(995)-g, adbSNP:201223598
complement(1006)-c, adbSNP:115786159
complement(1017)-dbSNP:
complement(1017)-t, cdbSNP:374237142
complement(1048)-t, cdbSNP:143690372
complement(1053)-g, adbSNP:138207610
complement(1055)-t, cdbSNP:5744758
complement(1070)-t, adbSNP:139075637
complement(1104)-t, cdbSNP:370727992
complement(1164)-dbSNP:
complement(1164)-t, cdbSNP:116162724
complement(1216)-g, adbSNP:5744760
complement(1223)-g, adbSNP:143102561
complement(1224)-t, cdbSNP:149029910
complement(1230)-dbSNP:
complement(1230)-c, adbSNP:137860861
complement(1256)-t, cdbSNP:200661323
complement(1271)-g, cdbSNP:145245295
complement(1273)-t, cdbSNP:141396559
complement(1290)-t, gdbSNP:201315364
complement(1298)-g, adbSNP:146639652
complement(1346)-dbSNP:
complement(1346)-g, adbSNP:376333939
complement(1347)-t, cdbSNP:199746481
complement(1397)-t, cdbSNP:371717068
complement(1486)-dbSNP:
complement(1486)-g, adbSNP:374920539
complement(1490)-g, adbSNP:371586756
complement(1491)-t, cdbSNP:150032060
complement(1497)-t, cdbSNP:140566004
complement(1505)-t, cdbSNP:142624113
complement(1518)-c, adbSNP:115047349
complement(1532)-t, cdbSNP:116573514
complement(1545)-g, adbSNP:200403177
complement(1546)-t, cdbSNP:151273553
complement(1548)-t, gdbSNP:376095661
complement(1556)-t, cdbSNP:142373951
complement(1614)-dbSNP:
complement(1614)-g, adbSNP:368303888
complement(1628)-g, adbSNP:369961557
complement(1671)-t, cdbSNP:375615461
complement(1679)-t, cdbSNP:5744777
complement(1690)-dbSNP:
complement(1690)-t, cdbSNP:192173820
complement(1694)-t, cdbSNP:116062148
complement(1743)-t, cdbSNP:113998091
complement(1746)-t, cdbSNP:200136603
complement(1769)-t, cdbSNP:201841065
complement(1783)-t, cdbSNP:74878897
complement(1792)-g, adbSNP:116263919
complement(1793)-t, cdbSNP:371824210
complement(1805)-g, adbSNP:114978673
complement(1806)-t, cdbSNP:374140892
complement(1850)-t, g, adbSNP:267603387
complement(1854)-g, adbSNP:115558715
complement(1867)-t, cdbSNP:145370369
complement(1904)-dbSNP:
complement(1904)-t, gdbSNP:139748472
complement(1911)-t, cdbSNP:115340410
complement(1916)-g, adbSNP:147438050
complement(1926)-g, adbSNP:373000452
complement(1944)-g, adbSNP:116260568
complement(1945)-t, cdbSNP:149296223
complement(1947)-t, gdbSNP:371149234
complement(1949)-g, adbSNP:114972594
complement(2045)-dbSNP:
complement(2045)-g, adbSNP:116456858
complement(2046)-t, cdbSNP:200471266
complement(2077)-t, cdbSNP:150564856
complement(2081)-g, adbSNP:368789955
complement(2106)-t, cdbSNP:141657198
complement(2111)-g, adbSNP:376673982
complement(2114)-g, adbSNP:145203544
complement(2158)-dbSNP:
complement(2158)-g, adbSNP:115559742
complement(2182)-t, adbSNP:199890659
complement(2202)-t, gdbSNP:367902268
complement(2237)-dbSNP:
complement(2237)-c, adbSNP:372677838
complement(2242)-g, adbSNP:116719126
complement(2260)-t, cdbSNP:369127106
complement(2262)-g, adbSNP:116326665
complement(2267)-t, gdbSNP:140254249
complement(2292)-t, adbSNP:5744799
complement(2298)-t, cdbSNP:5744800
complement(2299)-g, cdbSNP:36120395
complement(2307)-g, adbSNP:145793634
2315+g, tdbSNP:5744801
complement(2322)-g, adbSNP:200621883
complement(2339)-c, adbSNP:77327458
complement(2340)-g, adbSNP:374800058
complement(2344)-t, cdbSNP:115225325
complement(2357)-t, cdbSNP:115142739
complement(2370)-t, cdbSNP:142405043
complement(2380)-g, adbSNP:61734163
complement(2381)-t, cdbSNP:372240734
complement(2406)-dbSNP:
complement(2406)-t, cdbSNP:368153842
complement(2426)-t, cdbSNP:374750963
complement(2434)-t, cdbSNP:116360781
complement(2471)-g, adbSNP:145337550
complement(2502)-g, adbSNP:200825008
complement(2536)-dbSNP:
complement(2536)-t, cdbSNP:375791061
complement(2549)-g, adbSNP:5744822
complement(2549)-g, adbSNP:386599702
complement(2552)-t, cdbSNP:199751241
complement(2555)-g, adbSNP:114642756
complement(2556)-t, cdbSNP:371085002
complement(2559)-t, cdbSNP:147427999
complement(2586)-g, adbSNP:376624527
complement(2588)-g, adbSNP:200259552
complement(2598)-t, cdbSNP:142196181
complement(2608)-g, adbSNP:373379724
complement(2618)-t, cdbSNP:369150359
complement(2620)-c, adbSNP:201668507
complement(2651)-g, adbSNP:377036799
complement(2662)-t, cdbSNP:148691442
complement(2682)-dbSNP:
complement(2682)-g, adbSNP:200283666
complement(2687)-t, cdbSNP:375426113
complement(2690)-g, adbSNP:149513974
complement(2696)-t, cdbSNP:372109189
complement(2719)-g, adbSNP:139182500
complement(2724)-c, adbSNP:367964261
complement(2753)-g, cdbSNP:374905660
complement(2759)-t, cdbSNP:5744834
complement(2769)-t, cdbSNP:200179156
complement(2808)-dbSNP:
complement(2808)-t, cdbSNP:374200895
complement(2811)-g, adbSNP:115830215
complement(2847)-t, cdbSNP:138548494
complement(2892)-t, cdbSNP:201115064
complement(2907)-t, cdbSNP:150091117
complement(2979)-dbSNP:
complement(2979)-g, adbSNP:369751686
complement(2982)-g, adbSNP:141552148
complement(3001)-g, adbSNP:376546593
complement(3027)-t, cdbSNP:148382941
complement(3130)-dbSNP:
complement(3130)-t, cdbSNP:201333356
complement(3137)-t, cdbSNP:5744845
complement(3138)-t, cdbSNP:142563997
complement(3144)-g, adbSNP:56081968
complement(3172)-g, adbSNP:138391248
complement(3173)-t, cdbSNP:200080353
complement(3183)-t, cdbSNP:115193764
complement(3224)-g, adbSNP:376781169
complement(3255)-t, cdbSNP:147692158
complement(3258)-g, adbSNP:371831931
complement(3263)-g, adbSNP:201249963
complement(3305)-dbSNP:
complement(3305)-g, adbSNP:200122629
complement(3335)-g, adbSNP:5744856
complement(3350)-t, cdbSNP:368560398
3365+a, gdbSNP:5744857
complement(3412)-g, adbSNP:375338204
complement(3432)-t, adbSNP:145680387
complement(3438)-g, adbSNP:149777592
complement(3454)-t, cdbSNP:201744227
complement(3490)-dbSNP:
complement(3490)-g, adbSNP:372516267
complement(3506)-g, adbSNP:267603386
complement(3525)-t, cdbSNP:371545491
complement(3541)-c, adbSNP:114315196
complement(3542)-t, cdbSNP:200319525
complement(3555)-t, cdbSNP:184116505
complement(3564)-g, adbSNP:376921543
complement(3582)-g, adbSNP:139603739
complement(3586)-g, adbSNP:373707446
complement(3596)-dbSNP:
complement(3596)-g, adbSNP:371357642
complement(3620)-t, cdbSNP:368920055
complement(3698)-dbSNP:
complement(3698)-t, cdbSNP:5744888
complement(3715)-t, cdbSNP:374456899
complement(3743)-g, adbSNP:370133842
complement(3766)-g, adbSNP:112099123
complement(3803)-dbSNP:
complement(3803)-g, adbSNP:200803943
complement(3829)-g, adbSNP:144086049
complement(3855)-t, cdbSNP:200114024
complement(3876)-g, adbSNP:374039780
complement(3879)-c, adbSNP:369338222
complement(3880)-g, adbSNP:375208564
complement(3887)-g, adbSNP:139354109
complement(3907)-t, cdbSNP:201738371
complement(3925)-t, cdbSNP:146210785
complement(3927)-t, cdbSNP:113594027
complement(3934)-g, adbSNP:373213156
complement(3950)-t, cdbSNP:368978839
complement(3956)-t, cdbSNP:80290414
complement(3987)-t, cdbSNP:143858927
complement(4010)-dbSNP:
complement(4010)-t, cdbSNP:369436095
complement(4017)-c, adbSNP:199574832
complement(4027)-t, cdbSNP:377324348
complement(4058)-g, adbSNP:201848987
complement(4060)-t, cdbSNP:149462407
complement(4065)-g, adbSNP:373170535
complement(4071)-t, cdbSNP:200398117
complement(4090)-t, cdbSNP:115455318
complement(4100)-t, cdbSNP:375466233
complement(4110)-t, cdbSNP:112098447
complement(4121)-g, adbSNP:116482376
complement(4148)-t, cdbSNP:150282789
complement(4180)-t, cdbSNP:143981093
complement(4240)-dbSNP:
complement(4240)-g, adbSNP:368111350
complement(4256)-t, cdbSNP:201746181
complement(4260)-t, cdbSNP:138443282
complement(4264)-g, cdbSNP:147088333
complement(4266)-t, cdbSNP:141619382
complement(4292)-g, adbSNP:371912034
complement(4300)-t, cdbSNP:369171111
complement(4320)-g, adbSNP:151278283
complement(4334)-t, cdbSNP:374210113
complement(4349)-t, cdbSNP:199851128
complement(4353)-t, cdbSNP:5744904
complement(4353)-t, cdbSNP:386599706
complement(4354)-t, cdbSNP:143229302
complement(4378)-dbSNP:
complement(4378)-t, cdbSNP:200776293
complement(4381)-g, cdbSNP:149145495
complement(4393)-g, adbSNP:5744933
complement(4396)-g, adbSNP:5744934
4404+c, gdbSNP:5744935
complement(4408)-t, cdbSNP:370971579
complement(4445)-g, adbSNP:377245595
complement(4446)-t, cdbSNP:372901803
complement(4455)-t, cdbSNP:146711942
4468+c, tdbSNP:41561818
complement(4475)-g, adbSNP:369325608
complement(4476)-t, cdbSNP:139498590
complement(4504)-dbSNP:
complement(4504)-t, gdbSNP:371712284
complement(4517)-g, cdbSNP:367898059
complement(4527)-g, adbSNP:373785842
complement(4552)-t, cdbSNP:150545516
complement(4556)-t, cdbSNP:373631608
complement(4571)-g, adbSNP:115568973
complement(4610)-g, adbSNP:145477920
complement(4611)-g, adbSNP:139970867
complement(4621)-t, cdbSNP:113809231
complement(4665)-dbSNP:
complement(4665)-t, gdbSNP:201733230
4685+c, tdbSNP:5744943
complement(4709)-g, cdbSNP:370543622
complement(4732)-t, cdbSNP:142508245
4739+a, gdbSNP:5744944
complement(4739)-t, cdbSNP:386599709
complement(4743)-t, cdbSNP:147354120
complement(4750)-g, adbSNP:116742454
complement(4765)-dbSNP:
complement(4765)-t, cdbSNP:376530977
complement(4768)-g, cdbSNP:144045570
complement(4791)-t, cdbSNP:373468985
complement(4812)-t, cdbSNP:138564205
complement(4814)-g, cdbSNP:75930376
complement(4844)-g, adbSNP:199945393
complement(4854)-g, cdbSNP:147500308
4858+a, gdbSNP:5744947
complement(4858)-t, cdbSNP:386599710
complement(4869)-t, cdbSNP:143247306
complement(4925)-t, cdbSNP:138782478
complement(4928)-g, adbSNP:115219846
complement(4939)-dbSNP:
complement(4939)-c, adbSNP:5744948
complement(4939)-c, adbSNP:386599711
complement(4945)-t, cdbSNP:375590443
complement(4947)-g, adbSNP:192908615
complement(4948)-t, cdbSNP:201950040
complement(4968)-t, cdbSNP:372388555
complement(4984)-t, cdbSNP:115873219
complement(4999)-g, cdbSNP:75228172
complement(5010)-g, adbSNP:147467247
complement(5018)-c, adbSNP:75378940
complement(5030)-t, cdbSNP:369369339
complement(5061)-t, cdbSNP:377406943
complement(5097)-g, adbSNP:148076304
complement(5120)-g, adbSNP:267603385
complement(5150)-g, adbSNP:145639967
complement(5210)-dbSNP:
complement(5210)-g, adbSNP:112358554
complement(5211)-t, cdbSNP:371348453
complement(5212)-t, cdbSNP:368735471
complement(5216)-g, adbSNP:146761597
complement(5273)-t, adbSNP:56102033
complement(5315)-g, adbSNP:116001373
complement(5333)-g, adbSNP:114891564
complement(5344)-t, cdbSNP:5744950
complement(5349)-c, adbSNP:144941152
complement(5361)-t, cdbSNP:374381852
complement(5432)-dbSNP:
complement(5432)-c, adbSNP:184039394
complement(5446)-t, cdbSNP:377461656
complement(5447)-g, adbSNP:200128464
complement(5474)-t, cdbSNP:201967886
complement(5476)-t, adbSNP:199535980
complement(5487)-t, cdbSNP:373272795
complement(5496)-g, adbSNP:369742417
complement(5522)-t, cdbSNP:201803493
complement(5543)-g, adbSNP:11146986
complement(5556)-t, cdbSNP:149893630
complement(5560)-t, cdbSNP:139093285
5573+c, tdbSNP:5744955
complement(5591)-dbSNP:
complement(5591)-g, cdbSNP:368364666
complement(5607)-t, cdbSNP:199777048
complement(5619)-t, cdbSNP:374146891
complement(5621)-t, cdbSNP:144218410
complement(5661)-t, cdbSNP:140174561
complement(5705)-g, adbSNP:147543146
complement(5724)-g, adbSNP:141519273
complement(5725)-t, cdbSNP:370512955
complement(5751)-g, adbSNP:201001790
complement(5760)-g, adbSNP:185498408
complement(5779)-dbSNP:
complement(5779)-g, adbSNP:5744971
complement(5784)-g, cdbSNP:184253572
complement(5787)-g, cdbSNP:144343630
complement(5792)-c, adbSNP:5744972
complement(5804)-g, adbSNP:370958363
complement(5805)-t, cdbSNP:377662540
complement(5817)-g, adbSNP:138231414
complement(5841)-g, adbSNP:199979862
complement(5842)-t, cdbSNP:374022997
complement(5845)-t, cdbSNP:145621558
complement(5867)-g, adbSNP:369346799
complement(5868)-t, cdbSNP:114119067
complement(5871)-t, cdbSNP:368363850
complement(5876)-g, adbSNP:201962689
complement(5884)-g, cdbSNP:114173192
5916+dbSNP:
5916+c, tdbSNP:5744990
complement(5916)-g, adbSNP:386599714
complement(5935)-t, cdbSNP:201455049
complement(5945)-t, cdbSNP:369755963
complement(5972)-t, g, adbSNP:113976595
complement(5978)-g, adbSNP:375198950
complement(5979)-t, cdbSNP:371862779
complement(6013)-g, adbSNP:5744991
complement(6013)-g, adbSNP:386447433
complement(6020)-t, cdbSNP:368174082
complement(6052)-dbSNP:
complement(6052)-t, cdbSNP:372504703
complement(6071)-g, adbSNP:369929044
complement(6082)-t, cdbSNP:375406865
complement(6107)-t, cdbSNP:372044043
complement(6109)-g, adbSNP:201273415
complement(6110)-t, cdbSNP:200474862
complement(6126)-c, adbSNP:7487595
complement(6215)-dbSNP:
complement(6215)-t, cdbSNP:146902214
complement(6221)-g, adbSNP:147806951
complement(6227)-g, adbSNP:111709550
complement(6248)-g, adbSNP:371563366
complement(6258)-g, adbSNP:115452769
complement(6259)-t, cdbSNP:144178150
complement(6262)-t, cdbSNP:140344645
complement(6321)-t, cdbSNP:181570274
complement(6328)-t, cdbSNP:5745021
complement(6333)-t, cdbSNP:147954675
complement(6341..6342)-, adbSNP:35055217
complement(6344)-g, adbSNP:368662693
complement(6365)-dbSNP:
complement(6365)-t, cdbSNP:149841283
complement(6375)-t, cdbSNP:58916399
complement(6419)-t, adbSNP:139990705
6461+a, gdbSNP:5745022
complement(6481)-g, cdbSNP:376093362
complement(6491)-g, adbSNP:113581307
complement(6530)-g, adbSNP:201656807
complement(6532)-g, adbSNP:370363095
complement(6536)-g, adbSNP:371146029
complement(6543)-dbSNP:
complement(6543)-g, adbSNP:373443211
complement(6559..6560)-, tdbSNP:34241316
complement(6589)-t, cdbSNP:199613242
complement(6600)-g, adbSNP:369748519
complement(6601)-t, cdbSNP:141954509
complement(6614)-g, adbSNP:139607077
complement(6627)-g, adbSNP:5745066
complement(6655)-t, cdbSNP:201165149
complement(6662)-g, adbSNP:116076060
complement(6663)-t, cdbSNP:138789360
complement(6684)-t, cdbSNP:5745067
complement(6685)-t, cdbSNP:373092830
complement(6702)-g, adbSNP:369549727
complement(6703)-g, adbSNP:5745068
complement(6704)-g, adbSNP:114778730
complement(6716)-t, cdbSNP:375256819
complement(6717)-g, adbSNP:138094751
complement(6774)-dbSNP:
complement(6774)-t, adbSNP:150345709
complement(6785)-t, cdbSNP:368555884
complement(6806)-g, adbSNP:147611144
complement(6815)-t, cdbSNP:11146982
complement(6877)-dbSNP:
complement(6877)-t, cdbSNP:367970442
complement(6884)-g, adbSNP:149973644
complement(6923)-g, adbSNP:200082120
complement(6924)-t, cdbSNP:370305500
complement(6925)-g, adbSNP:190813054
complement(6939)-g, adbSNP:375741031
complement(6960)-dbSNP:
complement(6960)-g, adbSNP:373768478
complement(6964)-g, adbSNP:369576300
complement(6966)-g, cdbSNP:376140352
complement(6972)-t, adbSNP:73155056
complement(6974)-g, adbSNP:376336585
complement(6975)-t, cdbSNP:116323660
complement(6982)-g, adbSNP:71452531
complement(7004)-g, adbSNP:142222159
complement(7005)-t, cdbSNP:200911338
complement(7012)-g, adbSNP:373791036
complement(7026)-t, adbSNP:73481453
complement(7029)-g, cdbSNP:148788180
complement(7040)-c, adbSNP:145427269
complement(7094)-g, adbSNP:369104238
complement(7097)-g, adbSNP:376623391
complement(7102)-t, cdbSNP:371577331
7112+g, tdbSNP:5745083
complement(7114)-g, cdbSNP:113095243
complement(7120)-g, adbSNP:368916196
7136+a, gdbSNP:5745084
complement(7160)-t, cdbSNP:79419148
complement(7170)-g, adbSNP:372247840
complement(7188)-g, cdbSNP:138980040
complement(7203)-t, cdbSNP:146111596
complement(7314)-t, cdbSNP:386599717
complement(7314)-g, adbSNP:5745085
complement(7333)-c, adbSNP:368375403
complement(7334)-t, cdbSNP:5745086
complement(7347)-t, cdbSNP:183634984
complement(7363)-t, gdbSNP:137911728
complement(7416)-t, cdbSNP:191419597
complement(7440)-g, adbSNP:376098574
7458+, cdbSNP:5801983
complement(7494)-c, adbSNP:186570282
complement(7498)-g, adbSNP:371348285
complement(7499)-g, adbSNP:5745087
complement(7499)-g, adbSNP:386599718
7566+a, cdbSNP:5745088
complement(7566)-t, gdbSNP:386599719
complement(7604)-t, cdbSNP:5745089
complement(7605)-t, cdbSNP:14302
complement(7613)-t, cdbSNP:386599720
complement(7613)-g, adbSNP:5745090
complement(7684)-g, adbSNP:370411439
complement(7690)-g, adbSNP:5745091
complement(7706)-g, cdbSNP:373586675
complement(7856)-t, cdbSNP:11831601
complement(7975..7976)-c, adbSNP:11540669
complement(7976)-c, adbSNP:8435
complement(7983)-t, cdbSNP:5745092
complement(8004)-g, adbSNP:143493422
Gene SymbolPOLE
Gene SynonymCRCS12; FILS; POLE1
Chromosome12
Locus Map12q24.3
Title Polymerase proofreading-associated polyposis: a new, dominantly inherited syndrome of hereditary colorectal cancer predisposition .
Author Church JM.
Journal Dis. Colon Rectum 57 (3), 396-397 (2014)
Title Kinetic mechanism of DNA polymerization catalyzed by human DNA polymerase epsilon .
Author Zahurancik WJ, Klein SJ and Suo Z.
Journal Biochemistry 52 (40), 7041-7049 (2013)
Title DNA polymerase epsilon and delta exonuclease domain mutations in endometrial cancer .
Author Church DN, Briggs SE, Palles C, Domingo E, Kearsey SJ, Grimes JM, Gorman M, Martin L, Howarth KM, Hodgson SV, Kaur K, Taylor J and Tomlinson IP.
Journal Hum. Mol. Genet. 22 (14), 2820-2828 (2013)
Title Germline and somatic polymerase epsilon and delta mutations define a new class of hypermutated colorectal and endometrial cancers .
Author Briggs S and Tomlinson I.
Journal J. Pathol. 230 (2), 148-153 (2013)
Title Germline mutations affecting the proofreading domains of POLE and POLD1 predispose to colorectal adenomas and carcinomas .
Author Palles C, Cazier JB, Howarth KM, Domingo E, Jones AM, Broderick P, Kemp Z, Spain SL, Guarino E, Salguero I, Sherborne A, Chubb D, Carvajal-Carmona LG, Ma Y, Kaur K, Dobbins S, Barclay E, Gorman M, Martin L, Kovac MB, Humphray S, Lucassen A, Holmes CC, Bentley D, Donnelly P, Taylor J, Petridis C, Roylance R, Sawyer EJ, Kerr DJ, Clark S, Grimes J, Kearsey SE, Thomas HJ, McVean G, Houlston RS and Tomlinson I.
Journal Nat. Genet. 45 (2), 136-144 (2013)
Title Human DNA polymerase epsilon: enzymologic mechanism and gap-filling synthesis .
Author Mozzherin DJ and Fisher PA.
Journal Biochemistry 35 (11), 3572-3577 (1996)
Title Localization of the gene for DNA polymerase epsilon (POLE) to human chromosome 12q24.3 and rat chromosome 12 by somatic cell hybrid panels and fluorescence in situ hybridization .
Author Szpirer J, Pedeutour F, Kesti T, Riviere M, Syvaoja JE, Turc-Carel
Journal Genomics 20 (2), 223-226 (1994)
Title Molecular cloning of the cDNA for the catalytic subunit of human .
Author Kesti T, Frantti H and Syvaoja JE.
Journal J. Biol. Chem. 268 (14), 10238-10245 (1993)
Title The function of DNA polymerases in DNA repair synthesis of ultraviolet-irradiated human fibroblasts .
Author Popanda O and Thielmann HW.
Journal Biochim. Biophys. Acta 1129 (2), 155-160 (1992)
Title DNA primase from KB cells. Characterization of a primase activity tightly associated with immunoaffinity-purified DNA polymerase-alpha .
Author Wang,T.S., Hu,S.Z. and Korn,D.
Journal J. Biol. Chem. 259 (3), 1854-1865 (1984)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.