Homo sapiens POU class 3 homeobox 3 (POU3F3), mRNA.
| RefSeq Version | NM_006236.1, 5453935 |
| Length | 1503 bp |
| Structure | linear |
| Update Date | 22-JUL-2010 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens POU class 3 homeobox 3 (POU3F3), mRNA. |
| Product | POU domain, class 3, transcription factor 3 |
| Comment | Summary: POU3F3 is a member of the class III POU family of transcription factors (see POU3F1; MIM 602479) that are expressed in the central nervous system. The POU domain in these proteins is required for high affinity binding to octamer DNA sequences (summarized by Sumiyama et al., 1996 [PubMed 8703082]).[supplied by OMIM]. |
| RefSeq | NP_006227.1 |
| CDS | 1..1503 | Exon (1) | 1..1503 |
| Translation | MATAASNPYLPGNSLLAAGSIVHSDAAGAGGGGGGGGGGGGGGAGGGGGGMQPGSAAVTS
GAYRGDPSSVKMVQSDFMQGAMAASNGGHMLSHAHQWVTALPHAAAAAAAAAAAAVEASS
PWSGSAVGMAGSPQQPPQPPPPPPQGPDVKGGAGRDDLHAGTALHHRGPPHLGPPPPPPH
QGHPGGWGAAAAAAAAAAAAAAAAHLPSMAGGQQPPPQSLLYSQPGGFTVNGMLSAPPGP
GGGGGGAGGGAQSLVHPGLVRGDTPELAEHHHHHHHHAHPHPPHPHHAQGPPHHGGGGGG
AGPGLNSHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTI
CRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGA
LESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQ
VGTVSADTPPPHHGLQTSVQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 91 | + | , a | dbSNP:11363889 |
| 296 | + | a, g | dbSNP:6723328 |
| Title | The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors . |
| Author | Wissmuller,S., Kosian,T., Wolf,M., Finzsch,M. and Wegner,M. |
| Journal | Nucleic Acids Res. 34 (6), 1735-1744 (2006) |
| Title | Cooperative function of POU proteins and SOX proteins in glial cells . |
| Author | Kuhlbrodt,K., Herbarth,B., Sock,E., Enderich,J., Hermans-Borgmeyer,I. and Wegner,M. |
| Journal | J. Biol. Chem. 273 (26), 16050-16057 (1998) |
| Title | Human class III POU genes, POU3F1 and POU3F3, map to chromosomes 1p34.1 and 3p14.2 . |
| Author | Sumiyama,K., Washio-Watanabe,K., Ono,T., Yoshida,M.C., Hayakawa,T. and Ueda,S. |
| Journal | Mamm. Genome 9 (2), 180-181 (1998) |
| Title | The class III POU factor Brn-4 interacts with other class III POU factors and the heterogeneous nuclear ribonucleoprotein U . |
| Author | Malik,K.F., Jaffe,H., Brady,J. and Young,W.S. III. |
| Journal | Brain Res. Mol. Brain Res. 45 (1), 99-107 (1997) |
| Title | Class III POU genes: generation of homopolymeric amino acid repeats under GC pressure in mammals . |
| Author | Sumiyama,K., Washio-Watanabe,K., Saitou,N., Hayakawa,T. and Ueda,S. |
| Journal | J. Mol. Evol. 43 (3), 170-178 (1996) |
| Title | Expression of a large family of POU-domain regulatory genes in mammalian brain development . |
| Author | He,X., Treacy,M.N., Simmons,D.M., Ingraham,H.A., Swanson,L.W. and Rosenfeld,M.G. |
| Journal | Nature 340 (6228), 35-41 (1989) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |