• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens POU class 3 homeobox 3 (POU3F3), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_006236 Homo sapiens POU class 3 homeobox 3 (POU3F3), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_006236.1, 5453935
Length 1503 bp
Structure linear
Update Date 01-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens POU class 3 homeobox 3 (POU3F3), mRNA.
Product POU domain, class 3, transcription factor 3
Comment

Summary: POU3F3 is a member of the class III POU family of transcription factors (see POU3F1; MIM 602479) that are expressed in the central nervous system. The POU domain in these proteins is required for high affinity binding to octamer DNA sequences (summarized by Sumiyama et al., 1996 [PubMed 8703082]).[supplied by OMIM, Jul 2010].

RefSeq NP_006227.1
CDS 1..1503
Misc Feature(1)940..1164
Misc Feature(2)940..1164
Misc Feature(3)1219..1392
Misc Feature(4)order(1219..1233,1237..1239,1288..1290,1306..1308,
Misc Feature(5)order(1225..1227,1234..1236,1354..1356,1363..1368,
Translation MATAASNPYLPGNSLLAAGSIVHSDAAGAGGGGGGGGGGGGGGAGGGGGGMQPGSAAVTS GAYRGDPSSVKMVQSDFMQGAMAASNGGHMLSHAHQWVTALPHAAAAAAAAAAAAVEASS PWSGSAVGMAGSPQQPPQPPPPPPQGPDVKGGAGRDDLHAGTALHHRGPPHLGPPPPPPH QGHPGGWGAAAAAAAAAAAAAAAAHLPSMAGGQQPPPQSLLYSQPGGFTVNGMLSAPPGP GGGGGGAGGGAQSLVHPGLVRGDTPELAEHHHHHHHHAHPHPPHPHHAQGPPHHGGGGGG AGPGLNSHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTI CRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGA LESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQ VGTVSADTPPPHHGLQTSVQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
87+c, tdbSNP:186512421
200+c, gdbSNP:375481587
360+g, tdbSNP:191591917
774+a, gdbSNP:368850481
894+c, tdbSNP:372442573
972+a, gdbSNP:182992623
996+a, gdbSNP:377053693
1062+a, gdbSNP:371621473
1173+c, tdbSNP:199565525
1179+c, tdbSNP:140419524
1187+c, gdbSNP:146486201
1200+c, tdbSNP:143105467
1206+a, gdbSNP:140129722
1215+c, gdbSNP:137877846
1221+c, gdbSNP:372764445
1275+c, tdbSNP:377188135
1347+a, gdbSNP:147315122
1430+a, tdbSNP:377514724
1473+a, tdbSNP:202016096
1485+a, gdbSNP:374340255
Gene SymbolPOU3F3
Gene SynonymBRN1; OTF8
Chromosome2
Locus Map2q12.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006236 Homo sapiens POU class 3 homeobox 3 (POU3F3), mRNA. On-demand TBD TBD
Title Genetic association with overall survival of taxane-treated lung cancer patients - a genome-wide association study in human lymphoblastoid cell lines followed by a clinical association study .
Author Niu N, Schaid DJ, Abo RP, Kalari K, Fridley BL, Feng Q, Jenkins G, Batzler A, Brisbin AG, Cunningham JM, Li L, Sun Z, Yang P and Wang L.
Journal BMC Cancer 12, 422 (2012)
Title The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors .
Author Wissmuller S, Kosian T, Wolf M, Finzsch M and Wegner M.
Journal Nucleic Acids Res. 34 (6), 1735-1744 (2006)
Title Cooperative function of POU proteins and SOX proteins in glial cells .
Author Kuhlbrodt K, Herbarth B, Sock E, Enderich J, Hermans-Borgmeyer I and Wegner M.
Journal J. Biol. Chem. 273 (26), 16050-16057 (1998)
Title Human class III POU genes, POU3F1 and POU3F3, map to chromosomes 1p34.1 and 3p14.2 .
Author Sumiyama K, Washio-Watanabe K, Ono T, Yoshida MC, Hayakawa T and Ueda S.
Journal Mamm. Genome 9 (2), 180-181 (1998)
Title The class III POU factor Brn-4 interacts with other class III POU factors and the heterogeneous nuclear ribonucleoprotein U .
Author Malik KF, Jaffe H, Brady J and Young WS 3rd.
Journal Brain Res. Mol. Brain Res. 45 (1), 99-107 (1997)
Title Class III POU genes: generation of homopolymeric amino acid repeats under GC pressure in mammals .
Author Sumiyama K, Washio-Watanabe K, Saitou N, Hayakawa T and Ueda S.
Journal J. Mol. Evol. 43 (3), 170-178 (1996)
Title Expression of a large family of POU-domain regulatory genes in mammalian brain development .
Author He X, Treacy MN, Simmons DM, Ingraham HA, Swanson LW and Rosenfeld MG.
Journal Nature 340 (6228), 35-41 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.