• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens protein kinase C, delta (PRKCD), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_006254 Homo sapiens protein kinase C, delta (PRKCD), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_006254.3, 47157323
Length 2850 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens protein kinase C, delta (PRKCD), transcript variant 1, mRNA.
Product protein kinase C delta type
Comment

Summary: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play distinct roles in cells. The protein encoded by this gene is one of the PKC family members. Studies both in human and mice demonstrate that this kinase is involved in B cell signaling and in the regulation of growth, apoptosis, and differentiation of a variety of cell types. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript. Both variants encode the same protein.

RefSeq NP_006245.2
CDS 354..2384
Misc Feature(1)306..308
Misc Feature(2)495..497
Misc Feature(3)495..497
Misc Feature(4)507..509
Misc Feature(5)537..539
Misc Feature(6)543..545
Misc Feature(7)552..554
Misc Feature(8)720..722
Misc Feature(9)741..743
Misc Feature(10)816..818
Misc Feature(11)816..818
Misc Feature(12)828..977
Misc Feature(13)order(828..830,867..869,876..878,918..920,927..929,
Misc Feature(14)order(849..851,858..863,888..908)
Misc Feature(15)order(858..860,864..866)
Misc Feature(16)912..914
Misc Feature(17)1005..1007
Misc Feature(18)1044..1193
Misc Feature(19)order(1044..1046,1083..1085,1092..1094,1134..1136,
Misc Feature(20)order(1065..1067,1074..1079,1104..1124)
Misc Feature(21)order(1074..1076,1080..1082)
Misc Feature(22)1248..1250
Misc Feature(23)1257..1259
Misc Feature(24)1263..1265
Misc Feature(25)1272..1274
Misc Feature(26)1290..1292
Misc Feature(27)1290..1292
Misc Feature(28)1338..1343
Misc Feature(29)1353..1355
Misc Feature(30)1398..2162
Misc Feature(31)1410..2357
Misc Feature(32)order(1416..1430,1440..1442,1479..1481,1485..1487,
Misc Feature(33)order(1416..1427,1440..1442,1479..1481,1485..1487,
Misc Feature(34)order(1428..1430,1653..1655,1659..1661,1770..1772,
Misc Feature(35)1473..1475
Misc Feature(36)1473..1475
Misc Feature(37)1821..1892
Misc Feature(38)1860..1862
Misc Feature(39)1872..1874
Misc Feature(40)1872..1874
Misc Feature(41)1872..1874
Misc Feature(42)1872..1874
Misc Feature(43)1872..1874
Misc Feature(44)1893..1895
Misc Feature(45)2052..2054
Misc Feature(46)2052..2054
Misc Feature(47)2286..2288
Misc Feature(48)2286..2288
Misc Feature(49)2286..2288
Misc Feature(50)2286..2288
Misc Feature(51)2286..2288
Misc Feature(52)2286..2288
Misc Feature(53)2313..2315
Misc Feature(54)2325..2327
Misc Feature(55)2331..2348
Misc Feature(56)2343..2345
Misc Feature(57)2343..2345
Misc Feature(58)2343..2345
Misc Feature(59)2343..2345
Misc Feature(60)2343..2345
Misc Feature(61)2343..2345
Exon (1)1..222
Gene:PRKCD
Gene Synonym:CVID9; MAY1; nPKC-delta; PKCD
Exon (2)223..334
Gene:PRKCD
Gene Synonym:CVID9; MAY1; nPKC-delta; PKCD
Exon (3)335..468
Gene:PRKCD
Gene Synonym:CVID9; MAY1; nPKC-delta; PKCD
Exon (4)469..668
Gene:PRKCD
Gene Synonym:CVID9; MAY1; nPKC-delta; PKCD
Exon (5)669..729
Gene:PRKCD
Gene Synonym:CVID9; MAY1; nPKC-delta; PKCD
Exon (6)730..892
Gene:PRKCD
Gene Synonym:CVID9; MAY1; nPKC-delta; PKCD
Exon (7)893..924
Gene:PRKCD
Gene Synonym:CVID9; MAY1; nPKC-delta; PKCD
Exon (8)925..1010
Gene:PRKCD
Gene Synonym:CVID9; MAY1; nPKC-delta; PKCD
Exon (9)1011..1140
Gene:PRKCD
Gene Synonym:CVID9; MAY1; nPKC-delta; PKCD
Exon (10)1141..1241
Gene:PRKCD
Gene Synonym:CVID9; MAY1; nPKC-delta; PKCD
Exon (11)1242..1338
Gene:PRKCD
Gene Synonym:CVID9; MAY1; nPKC-delta; PKCD
Exon (12)1339..1439
Gene:PRKCD
Gene Synonym:CVID9; MAY1; nPKC-delta; PKCD
Exon (13)1440..1613
Gene:PRKCD
Gene Synonym:CVID9; MAY1; nPKC-delta; PKCD
Exon (14)1614..1705
Gene:PRKCD
Gene Synonym:CVID9; MAY1; nPKC-delta; PKCD
Exon (15)1706..1768
Gene:PRKCD
Gene Synonym:CVID9; MAY1; nPKC-delta; PKCD
Exon (16)1769..1907
Gene:PRKCD
Gene Synonym:CVID9; MAY1; nPKC-delta; PKCD
Exon (17)1908..2096
Gene:PRKCD
Gene Synonym:CVID9; MAY1; nPKC-delta; PKCD
Exon (18)2097..2225
Gene:PRKCD
Gene Synonym:CVID9; MAY1; nPKC-delta; PKCD
Exon (19)2226..2835
Gene:PRKCD
Gene Synonym:CVID9; MAY1; nPKC-delta; PKCD
Translation MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFD AHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQY FLEDVDCKQSMRSEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVW GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMS PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASR RSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSF GKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTK DHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVL LDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYE MLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIH PFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAF AGFSFVNPKFEHLLED
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
273+dbSNP:
273+c, tdbSNP:75666392
274+c, tdbSNP:80287513
360+c, tdbSNP:76625562
374+c, tdbSNP:373946656
375+a, gdbSNP:368029897
397+c, gdbSNP:369358922
410+c, tdbSNP:377115507
416+c, tdbSNP:369037399
421+c, tdbSNP:144572650
458+a, gdbSNP:141615361
472+dbSNP:
472+a, gdbSNP:376358631
complement(490)-g, adbSNP:79959723
527+a, gdbSNP:55719519
530+c, tdbSNP:369306770
533+c, tdbSNP:2230493
536+c, tdbSNP:145203229
545+c, tdbSNP:373034483
554+c, tdbSNP:188610371
559+c, tdbSNP:112659981
567+c, gdbSNP:151061939
complement(624)-g, cdbSNP:79725471
701+dbSNP:
701+a, gdbSNP:374573652
714+c, tdbSNP:377558890
725+c, tdbSNP:148137939
726+a, gdbSNP:370069134
727+c, tdbSNP:376476959
740+dbSNP:
740+a, gdbSNP:1135095
742+c, tdbSNP:79252610
747+c, tdbSNP:375221270
748+a, gdbSNP:200939049
758+c, tdbSNP:200462015
770+c, tdbSNP:56208295
799+a, gdbSNP:74793932
811+c, tdbSNP:370103982
833+a, gdbSNP:371324177
845+a, cdbSNP:187146419
920+dbSNP:
920+c, tdbSNP:150667829
950+dbSNP:
950+a, gdbSNP:74558112
956+c, tdbSNP:75794462
957+a, gdbSNP:149165175
983+c, tdbSNP:151199013
986+c, tdbSNP:372745352
987+a, gdbSNP:375512516
989+a, gdbSNP:200410934
1016+dbSNP:
1016+a, gdbSNP:137874318
1031+c, tdbSNP:78938657
1043+a, gdbSNP:55865871
1054+a, gdbSNP:140841846
1068+a, gdbSNP:369236318
1094+c, tdbSNP:55709737
1095+a, gdbSNP:144320413
1097+c, tdbSNP:147545646
1146+dbSNP:
1146+a, gdbSNP:373245386
1171+a, gdbSNP:377512214
1193+c, tdbSNP:145324216
1199+a, cdbSNP:372028715
1223+a, cdbSNP:370808161
1252+dbSNP:
1252+a, gdbSNP:143488209
1268+c, tdbSNP:201862364
1292+c, tdbSNP:368866073
1301+c, tdbSNP:138049008
1302+a, gdbSNP:55929201
1313+c, tdbSNP:143202454
1314+a, gdbSNP:372047510
1340+dbSNP:
1340+a, cdbSNP:373073065
1344+a, gdbSNP:140359417
1348+a, gdbSNP:377377410
1354+a, gdbSNP:34297342
1379+c, tdbSNP:199752526
1396+a, gdbSNP:33911937
1397+a, cdbSNP:59688439
1434+a, gdbSNP:369078144
1472+dbSNP:
1472+a, c, gdbSNP:2230494
1477+c, tdbSNP:1056998
1509+c, tdbSNP:374287889
1559+a, gdbSNP:74485893
1565+c, tdbSNP:200149825
1566+a, gdbSNP:150331740
1581+c, tdbSNP:34502209
1597+a, gdbSNP:35181307
1630+dbSNP:
1630+a, tdbSNP:372295257
1646+c, tdbSNP:377107086
1652+a, gdbSNP:200890839
1683+c, tdbSNP:372673092
1695+a, tdbSNP:141979341
1715+dbSNP:
1715+c, tdbSNP:41295962
1763+c, tdbSNP:201154167
1794+dbSNP:
1794+c, tdbSNP:2306574
1800+c, tdbSNP:35891605
1853+c, tdbSNP:149751382
1900+, cdbSNP:34971355
1904+c, tdbSNP:148833677
1955+dbSNP:
1955+c, tdbSNP:79490732
1970+c, tdbSNP:375360762
2024+c, tdbSNP:147601598
2044+c, tdbSNP:146289210
2058+c, tdbSNP:141992569
2059+a, gdbSNP:138712106
2123+dbSNP:
2123+a, gdbSNP:77870723
2134+c, tdbSNP:146302697
2135+c, gdbSNP:1075865
2197+g, tdbSNP:74838104
2210+c, tdbSNP:900495
2215+, gdbSNP:34738769
2223+a, gdbSNP:79000840
2234+dbSNP:
2234+c, tdbSNP:199634315
2279+a, gdbSNP:56338517
2281+a, gdbSNP:369041593
2287+c, tdbSNP:142844487
2309+c, tdbSNP:147565728
2333+c, tdbSNP:2230497
2334+a, gdbSNP:149202171
2355+c, tdbSNP:148364495
2406+a, gdbSNP:372770730
2428+a, tdbSNP:115951896
2522+c, tdbSNP:59159087
2657..2658+, atdbSNP:35020629
2668..2669+, tadbSNP:10600423
2755..2756+, adbSNP:370040136
2755+a, cdbSNP:201812873
2756..2757+, adbSNP:72190282
2770..2771+, adbSNP:386396652
2770..2771+, a, aaadbSNP:56144970
Gene SymbolPRKCD
Gene SynonymCVID9; MAY1; nPKC-delta; PKCD
Chromosome3
Locus Map3p21.31
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006254 Homo sapiens protein kinase C, delta (PRKCD), transcript variant 1, mRNA. On-demand $849.00 20
NM_212539 Homo sapiens protein kinase C, delta (PRKCD), transcript variant 2, mRNA. On-demand $849.00 20
XM_006713257 PREDICTED: Homo sapiens protein kinase C, delta (PRKCD), transcript variant X1, mRNA. On-demand $849.00 20
XM_006713258 PREDICTED: Homo sapiens protein kinase C, delta (PRKCD), transcript variant X2, mRNA. On-demand $849.00 20
XM_006713259 PREDICTED: Homo sapiens protein kinase C, delta (PRKCD), transcript variant X3, mRNA. On-demand $849.00 20
Title Protein kinase Cdelta-mediated phosphorylation of Connexin43 gap junction channels causes movement within gap junctions followed by vesicle internalization and protein degradation .
Author Cone AC, Cavin G, Ambrosi C, Hakozaki H, Wu-Zhang AX, Kunkel MT, Newton AC and Sosinsky GE.
Journal J. Biol. Chem. 289 (13), 8781-8798 (2014)
Title PKCdelta as a regulator for TGF-beta-stimulated connective tissue growth factor production in human hepatocarcinoma (HepG2) cells .
Author Lee SJ, Kang JH, Choi SY and Kwon OS.
Journal Biochem. J. 456 (1), 109-118 (2013)
Title Phosphoproteomics study on the activated PKCdelta-induced cell death .
Author Xia L, Wang TD, Shen SM, Zhao M, Sun H, He Y, Xie L, Wu ZX, Han SF, Wang LS and Chen GQ.
Journal J. Proteome Res. 12 (10), 4280-4301 (2013)
Title Interleukin (IL)-32beta-mediated CCAAT/enhancer-binding protein alpha (C/EBPalpha) phosphorylation by protein kinase Cdelta (PKCdelta) abrogates the inhibitory effect of C/EBPalpha on IL-10 production .
Author Kang JW, Park YS, Kim MS, Lee DH, Bak Y, Ham SY, Park SH, Hong JT and Yoon DY.
Journal J. Biol. Chem. 288 (33), 23650-23658 (2013)
Title Protein kinase cdelta deficiency causes mendelian systemic lupus erythematosus with B cell-defective apoptosis and hyperproliferation .
Author Belot A, Kasher PR, Trotter EW, Foray AP, Debaud AL, Rice GI, Szynkiewicz M, Zabot MT, Rouvet I, Bhaskar SS, Daly SB, Dickerson JE, Mayer J, O'Sullivan J, Juillard L, Urquhart JE, Fawdar S, Marusiak AA, Stephenson N, Waszkowycz B, W Beresford M, Biesecker LG, C M Black G, Rene C, Eliaou JF, Fabien N, Ranchin B, Cochat P, Gaffney PM, Rozenberg F, Lebon P, Malcus C, Crow YJ, Brognard J and Bonnefoy N.
Journal Arthritis Rheum. 65 (8), 2161-2171 (2013)
Title Identification of lamin B2 as a substrate of protein kinase C in BALB/MK-2 mouse keratinocytes .
Author Kasahara K, Chida K, Tsunenaga M, Kohno Y, Ikuta T and Kuroki T.
Journal J. Biol. Chem. 266 (30), 20018-20023 (1991)
Title A synthetic peptide substrate for initiation factor-2 kinases .
Author Mellor H and Proud CG.
Journal Biochem. Biophys. Res. Commun. 178 (2), 430-437 (1991)
Title Phorbol-ester-induced phosphorylation of the beta 2-adrenergic receptor decreases its coupling to Gs .
Author Bouvier M, Guilbault N and Bonin H.
Journal FEBS Lett. 279 (2), 243-248 (1991)
Title Activated protein kinase C directly phosphorylates the CD34 antigen on hematopoietic cells .
Author Fackler MJ, Civin CI, Sutherland DR, Baker MA and May WS.
Journal J. Biol. Chem. 265 (19), 11056-11061 (1990)
Title Trans-activation of HIV-1 LTR-directed gene expression by tat requires protein kinase C .
Author Jakobovits A, Rosenthal A and Capon DJ.
Journal EMBO J. 9 (4), 1165-1170 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.