• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens protein kinase N2 (PKN2), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_006256 Homo sapiens protein kinase N2 (PKN2), mRNA. GenEZ ORF Cloning On-demand $899.00 20

*Business Day

Related Services

RefSeq Version NM_006256.2, 106507281
Length 6104 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens protein kinase N2 (PKN2), mRNA.
Product serine/threonine-protein kinase N2
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DA451427.1, U33052.1 and AL136381.12. On Jun 2, 2006 this sequence version replaced gi:5453973.

RefSeq NP_006247.1
CDS 343..3297
Misc Feature(1)169..171
Misc Feature(2)472..699
Misc Feature(3)472..699
Misc Feature(4)<535..>597
Misc Feature(5)order(535..540,544..549,556..561,568..570,583..588,
Misc Feature(6)670..672
Misc Feature(7)691..693
Misc Feature(8)691..693
Misc Feature(9)703..705
Misc Feature(10)712..714
Misc Feature(11)730..945
Misc Feature(12)739..981
Misc Feature(13)order(757..759,766..768,775..780,787..792,796..801,
Misc Feature(14)order(781..786,790..795,802..807,811..816,823..828,
Misc Feature(15)967..1188
Misc Feature(16)982..1227
Misc Feature(17)order(1000..1002,1009..1011,1018..1023,1030..1035,
Misc Feature(18)order(1024..1029,1033..1038,1045..1050,1054..1059,
Misc Feature(19)1207..1209
Misc Feature(20)1246..1248
Misc Feature(21)1258..1260
Misc Feature(22)1420..1422
Misc Feature(23)1426..1428
Misc Feature(24)1486..1731
Misc Feature(25)1510..1761
Misc Feature(26)1945..1947
Misc Feature(27)2086..2088
Misc Feature(28)2089..2091
Misc Feature(29)2089..2091
Misc Feature(30)2224..2226
Misc Feature(31)2233..2235
Misc Feature(32)2245..2247
Misc Feature(33)2311..3282
Misc Feature(34)2326..3090
Misc Feature(35)order(2329..2343,2353..2355,2392..2394,2398..2400,
Misc Feature(36)order(2329..2334,2353..2355,2392..2394,2398..2400,
Misc Feature(37)order(2341..2343,2572..2574,2578..2580,2686..2688,
Misc Feature(38)2440..2442
Misc Feature(39)2440..2442
Misc Feature(40)2737..2808
Misc Feature(41)2788..2790
Misc Feature(42)2788..2790
Misc Feature(43)2788..2790
Misc Feature(44)2788..2790
Misc Feature(45)3091..3273
Misc Feature(46)3193..3195
Misc Feature(47)3193..3195
Misc Feature(48)3214..3216
Misc Feature(49)3214..3216
Misc Feature(50)3214..3216
Misc Feature(51)3262..3279
Misc Feature(52)3274..3294
Exon (1)1..390
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042
Exon (2)391..691
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042
Exon (3)692..846
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042
Exon (4)847..964
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042
Exon (5)965..1110
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042
Exon (6)1111..1327
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042
Exon (7)1328..1513
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042
Exon (8)1514..1623
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042
Exon (9)1624..1767
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042
Exon (10)1768..1843
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042
Exon (11)1844..2018
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042
Exon (12)2019..2145
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042
Exon (13)2146..2276
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042
Exon (14)2277..2352
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042
Exon (15)2353..2444
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042
Exon (16)2445..2621
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042
Exon (17)2622..2684
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042
Exon (18)2685..2761
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042
Exon (19)2762..2904
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042
Exon (20)2905..3012
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042
Exon (21)3013..3093
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042
Exon (22)3094..6104
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042
Translation MASNPERGEILLTELQGDSRSLPFSENVSAVQKLDFSDTMVQQKLDDIKDRIKREIRKEL KIKEGAENLRKVTTDKKSLAYVDNILKKSNKKLEELHHKLQELNAHIVVSDPEDITDCPR TPDTPNNDPRCSTSNNRLKALQKQLDIELKVKQGAENMIQMYSNGSSKDRKLHGTAQQLL QDSKTKIEVIRMQILQAVQTNELAFDNAKPVISPLELRMEELRHHFRIEFAVAEGAKNVM KLLGSGKVTDRKALSEAQARFNESSQKLDLLKYSLEQRLNEVPKNHPKSRIIIEELSLVA ASPTLSPRQSMISTQNQYSTLSKPAALTGTLEVRLMGCQDILENVPGRSKATSVALPGWS PSETRSSFMSRTSKSKSGSSRNLLKTDDLSNDVCAVLKLDNTVVGQTSWKPISNQSWDQK FTLELDRSRELEISVYWRDWRSLCAVKFLRLEDFLDNQRHGMCLYLEPQGTLFAEVTFFN PVIERRPKLQRQKKIFSKQQGKTFLRAPQMNINIATWGRLVRRAIPTVNHSGTFSPQAPV PTTVPVVDVRIPQLAPPASDSTVTKLDFDLEPEPPPAPPRASSLGEIDESSELRVLDIPG QDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFRCC AVLGRGHFGKVLLAEYKNTNEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFL VNLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEHKIVY RDLKLDNLLLDTEGFVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTETSYTRAVDW WGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRL GASEKDAEDVKKHPFFRLIDWSALMDKKVKPPFIPTIRGREDVSNFDDEFTSEAPILTPP REPRILSEEEQEMFRDFDYIADWC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
153+dbSNP:
153+c, tdbSNP:201410349
230+, tdbSNP:10713037
241+c, tdbSNP:77280369
460+dbSNP:
460+a, gdbSNP:199689449
494+a, gdbSNP:200490316
520+c, tdbSNP:201117208
624+a, cdbSNP:12039846
704+dbSNP:
704+c, tdbSNP:201995133
763+a, gdbSNP:430600
896+dbSNP:
896+c, tdbSNP:202004408
932+a, cdbSNP:35207128
1077+dbSNP:
1077+a, gdbSNP:201013196
1078..1079+, gdbSNP:34602652
1160+dbSNP:
1160+a, gdbSNP:148288884
1161+c, tdbSNP:201690209
1187+, tdbSNP:66931534
1289+a, gdbSNP:111704755
1321+c, tdbSNP:9651072
1360..1361+dbSNP:
1360..1361+, tdbSNP:34708108
1365+c, gdbSNP:201111346
1398+a, cdbSNP:201865794
1433+c, tdbSNP:200726637
1454+a, gdbSNP:187178031
1488..1490+, tctdbSNP:201679232
1716+dbSNP:
1716+a, gdbSNP:56365263
1821+dbSNP:
1821+a, gdbSNP:147713481
1845+dbSNP:
1845+c, tdbSNP:200022569
1953+a, gdbSNP:201758727
1963+c, tdbSNP:201149414
1974+g, tdbSNP:191397480
2019+dbSNP:
2019+a, gdbSNP:786906
2226+dbSNP:
2226+c, tdbSNP:200217727
2286+dbSNP:
2286+a, gdbSNP:201749502
2306+a, gdbSNP:12085658
2352+a, gdbSNP:6671949
2356+dbSNP:
2356+c, tdbSNP:200476994
2478+dbSNP:
2478+a, gdbSNP:199566133
2595+g, tdbSNP:200519077
2985+dbSNP:
2985+c, tdbSNP:76430567
3067+dbSNP:
3067+a, gdbSNP:201403675
3092+a, gdbSNP:188265897
3185+a, gdbSNP:200518024
3195+c, tdbSNP:193170277
3242+c, tdbSNP:200905692
3289+c, tdbSNP:184754507
3397..3399+, ttgdbSNP:148906887
3418+a, gdbSNP:187904669
3456..3458+, aagdbSNP:3831022
3497+c, tdbSNP:76669528
3518+c, tdbSNP:147551533
3539+a, gdbSNP:141963409
3561+g, tdbSNP:145835594
3595+a, gdbSNP:11541543
3676+a, gdbSNP:151165483
3715+a, cdbSNP:191409712
3759..3760+, tdbSNP:199950121
3766..3767+, adbSNP:142129138
3766+a, tdbSNP:183934392
3767..3768+, adbSNP:61703221
3767+a, tdbSNP:57445331
3821+g, tdbSNP:79463875
3837+a, tdbSNP:181363261
3878+c, gdbSNP:150349508
3997+a, cdbSNP:11541544
4017+g, tdbSNP:61118957
4041+c, tdbSNP:138057302
4148+a, tdbSNP:115260590
4176+a, gdbSNP:12027005
4233+a, gdbSNP:76442107
4252+g, tdbSNP:184959864
4431+g, tdbSNP:201266373
4619+c, tdbSNP:76107017
4749+a, tdbSNP:74392918
4844+g, tdbSNP:79294200
4986+c, tdbSNP:149526423
5083..5084+, ttdbSNP:71778817
5109+a, gdbSNP:189841196
5206+a, tdbSNP:144889137
5217+, ttdbSNP:71693414
5235+a, gdbSNP:181568060
5259+c, gdbSNP:186252655
5289+c, g, tdbSNP:786912
5290+a, gdbSNP:138185887
5311+, tdbSNP:34982854
5346..5348+, agadbSNP:201147667
5409+a, tdbSNP:11800810
5413+a, gdbSNP:146070743
5437+g, tdbSNP:148737509
5481..5484+, tgtadbSNP:200537391
5595+c, tdbSNP:141492534
6059+g, tdbSNP:191056745
Gene SymbolPKN2
Gene SynonymPak-2; PAK2; PRK2; PRKCL2; PRO2042
Chromosome1
Locus Map1p22.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006256 Homo sapiens protein kinase N2 (PKN2), mRNA. On-demand $899.00 20
Title Regulation of protein kinase C-related protein kinase 2 (PRK2) by an intermolecular PRK2-PRK2 interaction mediated by Its N-terminal domain .
Author Bauer,A.F., Sonzogni,S., Meyer,L., Zeuzem,S., Piiper,A., Biondi,R.M. and Neimanis,S.
Journal J. Biol. Chem. 287 (24), 20590-20602 (2012)
Title Destabilization of PDK1 by Hsp90 inactivation suppresses hepatitis .
Author Kim,M.G., Moon,J.S., Kim,E.J., Lee,S.H. and Oh,J.W.
Journal Biochem. Biophys. Res. Commun. 421 (1), 112-118 (2012)
Title Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma .
Author Chambers,J.C., Zhang,W., Sehmi,J., Li,X., Wass,M.N., Van der Harst,P., Holm,H., Sanna,S., Kavousi,M., Baumeister,S.E., Coin,L.J., Deng,G., Gieger,C., Heard-Costa,N.L., Hottenga,J.J., Kuhnel,B., Kumar,V., Lagou,V., Liang,L., Luan,J., Vidal,P.M., Mateo Leach,I., O'Reilly,P.F., Peden,J.F., Rahmioglu,N., Soininen,P., Speliotes,E.K., Yuan,X., Thorleifsson,G., Alizadeh,B.Z., Atwood,L.D., Borecki,I.B., Brown,M.J., Charoen,P., Cucca,F., Das,D., de Geus,E.J., Dixon,A.L., Doring,A., Ehret,G., Eyjolfsson,G.I., Farrall,M., Forouhi,N.G., Friedrich,N., Goessling,W., Gudbjartsson,D.F., Harris,T.B., Hartikainen,A.L., Heath,S., Hirschfield,G.M., Hofman,A., Homuth,G., Hypponen,E., Janssen,H.L., Johnson,T., Kangas,A.J., Kema,I.P., Kuhn,J.P., Lai,S., Lathrop,M., Lerch,M.M., Li,Y., Liang,T.J., Lin,J.P., Loos,R.J., Martin,N.G., Moffatt,M.F., Montgomery,G.W., Munroe,P.B., Musunuru,K., Nakamura,Y., O'Donnell,C.J., Olafsson,I., Penninx,B.W., Pouta,A., Prins,B.P., Prokopenko,I., Puls,R., Ruokonen,A., Savolainen,M.J., Schlessinger,D., Schouten,J.N., Seedorf,U., Sen-Chowdhry,S., Siminovitch,K.A., Smit,J.H., Spector,T.D., Tan,W., Teslovich,T.M., Tukiainen,T., Uitterlinden,A.G., Van der Klauw,M.M., Vasan,R.S., Wallace,C., Wallaschofski,H., Wichmann,H.E., Willemsen,G., Wurtz,P., Xu,C., Yerges-Armstrong,L.M., Abecasis,G.R., Ahmadi,K.R., Boomsma,D.I., Caulfield,M., Cookson,W.O., van Duijn,C.M., Froguel,P., Matsuda,K., McCarthy,M.I., Meisinger,C., Mooser,V., Pietilainen,K.H., Schumann,G., Snieder,H., Sternberg,M.J., Stolk,R.P., Thomas,H.C., Thorsteinsdottir,U., Uda,M., Waeber,G., Wareham,N.J., Waterworth,D.M., Watkins,H., Whitfield,J.B., Witteman,J.C., Wolffenbuttel,B.H., Fox,C.S., Ala-Korpela,M., Stefansson,K., Vollenweider,P., Volzke,H., Schadt,E.E., Scott,J., Jarvelin,M.R., Elliott,P. and Kooner,J.S.
Journal Nat. Genet. 43 (11), 1131-1138 (2011)
Title The Rho target PRK2 regulates apical junction formation in human bronchial epithelial cells .
Author Wallace,S.W., Magalhaes,A. and Hall,A.
Journal Mol. Cell. Biol. 31 (1), 81-91 (2011)
Title Regulatory domain selectivity in the cell-type specific PKN-dependence of cell migration .
Author Lachmann,S., Jevons,A., De Rycker,M., Casamassima,A., Radtke,S., Collazos,A. and Parker,P.J.
Journal PLoS ONE 6 (7), E21732 (2011)
Title Isolation and characterization of a structural homologue of human PRK2 from rat liver. Distinguishing substrate and lipid activator specificities .
Author Yu,W., Liu,J., Morrice,N.A. and Wettenhall,R.E.
Journal J. Biol. Chem. 272 (15), 10030-10034 (1997)
Title The PRK2 kinase is a potential effector target of both Rho and Rac GTPases and regulates actin cytoskeletal organization .
Author Vincent,S. and Settleman,J.
Journal Mol. Cell. Biol. 17 (4), 2247-2256 (1997)
Title Isolation of a NCK-associated kinase, PRK2, an SH3-binding protein and potential effector of Rho protein signaling .
Author Quilliam,L.A., Lambert,Q.T., Mickelson-Young,L.A., Westwick,J.K., Sparks,A.B., Kay,B.K., Jenkins,N.A., Gilbert,D.J., Copeland,N.G. and Der,C.J.
Journal J. Biol. Chem. 271 (46), 28772-28776 (1996)
Title Cloning and expression patterns of two members of a novel protein-kinase-C-related kinase family .
Author Palmer,R.H., Ridden,J. and Parker,P.J.
Journal Eur. J. Biochem. 227 (1-2), 344-351 (1995)
Title Identification of multiple, novel, protein kinase C-related gene products .
Author Palmer,R.H., Ridden,J. and Parker,P.J.
Journal FEBS Lett. 356 (1), 5-8 (1994)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.