• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens protein kinase N2 (PKN2), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu17044 Homo sapiens protein kinase N2 (PKN2), mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu17044C Homo sapiens protein kinase N2 (PKN2), mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_006256.2, 106507281
Length 2955 bp
Structure linear
Update Date 26-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens protein kinase N2 (PKN2), mRNA.
Product serine/threonine-protein kinase N2
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DA451427.1, U33052.1 and AL136381.12. On Jun 2, 2006 this sequence version replaced gi:5453973.

RefSeq NP_006247.1
CDS 343..3297
Misc Feature(1)169..171
Misc Feature(2)466..663
Misc Feature(3)466..663
Misc Feature(4)472..699
Misc Feature(5)order(490..492,499..501,508..513,520..525,529..534,
Misc Feature(6)order(514..519,523..528,535..540,544..549,556..561,
Misc Feature(7)670..672
Misc Feature(8)691..696
Misc Feature(9)691..693
Misc Feature(10)703..705
Misc Feature(11)712..714
Misc Feature(12)730..945
Misc Feature(13)739..981
Misc Feature(14)order(757..759,766..768,775..780,787..792,796..801,
Misc Feature(15)order(781..786,790..795,802..807,811..816,823..828,
Misc Feature(16)967..1188
Misc Feature(17)982..1227
Misc Feature(18)order(1000..1002,1009..1011,1018..1023,1030..1035,
Misc Feature(19)order(1024..1029,1033..1038,1045..1050,1054..1059,
Misc Feature(20)1207..1209
Misc Feature(21)1246..1248
Misc Feature(22)1258..1260
Misc Feature(23)1420..1422
Misc Feature(24)1426..1428
Misc Feature(25)1486..1731
Misc Feature(26)1510..1761
Misc Feature(27)1945..1947
Misc Feature(28)2086..2088
Misc Feature(29)2089..2091
Misc Feature(30)2089..2091
Misc Feature(31)2224..2226
Misc Feature(32)2233..2235
Misc Feature(33)2245..2247
Misc Feature(34)2311..3282
Misc Feature(35)2326..3090
Misc Feature(36)order(2329..2343,2353..2355,2392..2394,2398..2400,
Misc Feature(37)order(2329..2334,2353..2355,2392..2394,2398..2400,
Misc Feature(38)order(2341..2343,2572..2574,2578..2580,2686..2688,
Misc Feature(39)2440..2445
Misc Feature(40)2440..2442
Misc Feature(41)2737..2808
Misc Feature(42)2788..2790
Misc Feature(43)2788..2790
Misc Feature(44)2788..2790
Misc Feature(45)2788..2790
Misc Feature(46)3091..3273
Misc Feature(47)3193..3195
Misc Feature(48)3193..3195
Misc Feature(49)3214..3216
Misc Feature(50)3214..3216
Misc Feature(51)3214..3216
Misc Feature(52)3262..3279
Misc Feature(53)3274..3294
Exon (1)1..390
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Exon (2)391..691
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Exon (3)692..846
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Exon (4)847..964
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Exon (5)965..1110
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Exon (6)1111..1327
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Exon (7)1328..1513
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Exon (8)1514..1623
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Exon (9)1624..1767
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Exon (10)1768..1843
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Exon (11)1844..2018
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Exon (12)2019..2145
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Exon (13)2146..2276
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Exon (14)2277..2352
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Exon (15)2353..2444
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Exon (16)2445..2621
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Exon (17)2622..2684
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Exon (18)2685..2761
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Exon (19)2762..2904
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Exon (20)2905..3012
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Exon (21)3013..3093
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Exon (22)3094..6104
Gene:PKN2
Gene Synonym:Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Translation MASNPERGEILLTELQGDSRSLPFSENVSAVQKLDFSDTMVQQKLDDIKDRIKREIRKEL KIKEGAENLRKVTTDKKSLAYVDNILKKSNKKLEELHHKLQELNAHIVVSDPEDITDCPR TPDTPNNDPRCSTSNNRLKALQKQLDIELKVKQGAENMIQMYSNGSSKDRKLHGTAQQLL QDSKTKIEVIRMQILQAVQTNELAFDNAKPVISPLELRMEELRHHFRIEFAVAEGAKNVM KLLGSGKVTDRKALSEAQARFNESSQKLDLLKYSLEQRLNEVPKNHPKSRIIIEELSLVA ASPTLSPRQSMISTQNQYSTLSKPAALTGTLEVRLMGCQDILENVPGRSKATSVALPGWS PSETRSSFMSRTSKSKSGSSRNLLKTDDLSNDVCAVLKLDNTVVGQTSWKPISNQSWDQK FTLELDRSRELEISVYWRDWRSLCAVKFLRLEDFLDNQRHGMCLYLEPQGTLFAEVTFFN PVIERRPKLQRQKKIFSKQQGKTFLRAPQMNINIATWGRLVRRAIPTVNHSGTFSPQAPV PTTVPVVDVRIPQLAPPASDSTVTKLDFDLEPEPPPAPPRASSLGEIDESSELRVLDIPG QDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFRCC AVLGRGHFGKVLLAEYKNTNEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFL VNLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEHKIVY RDLKLDNLLLDTEGFVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTETSYTRAVDW WGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRL GASEKDAEDVKKHPFFRLIDWSALMDKKVKPPFIPTIRGREDVSNFDDEFTSEAPILTPP REPRILSEEEQEMFRDFDYIADWC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
153+dbSNP:
153+c, tdbSNP:201410349
241+c, tdbSNP:77280369
308+g, tdbSNP:370061054
369+a, gdbSNP:372711172
401+dbSNP:
401+a, gdbSNP:369171613
403+a, gdbSNP:370072062
410+c, tdbSNP:375306359
453+a, gdbSNP:377515876
460+a, gdbSNP:199689449
494+a, gdbSNP:200490316
520+c, tdbSNP:201117208
561+a, gdbSNP:368643241
624+a, cdbSNP:12039846
676+c, gdbSNP:372785607
704+dbSNP:
704+c, tdbSNP:201995133
751+a, gdbSNP:369178376
complement(763)-g, adbSNP:430600
868+dbSNP:
868+a, gdbSNP:376874389
876+a, gdbSNP:369228973
896+c, tdbSNP:202004408
932+a, cdbSNP:35207128
932+a, cdbSNP:386439184
1077+dbSNP:
1077+a, gdbSNP:201013196
1079..1080+, gdbSNP:34602652
1118+dbSNP:
1118+c, tdbSNP:375574349
1144+c, tdbSNP:368591525
1160+a, gdbSNP:148288884
1161+c, tdbSNP:201690209
1182+c, tdbSNP:373700833
1203+c, tdbSNP:368171924
1220+c, tdbSNP:371630794
1271+c, gdbSNP:373232178
1284+g, tdbSNP:374860858
1289+a, gdbSNP:111704755
1314+a, gdbSNP:368519297
1321+c, tdbSNP:9651072
1360..1361+dbSNP:
1360..1361+, tdbSNP:34708108
1365+c, gdbSNP:201111346
1398+a, cdbSNP:201865794
1423+c, tdbSNP:368676500
1433+c, tdbSNP:200726637
1454+a, gdbSNP:187178031
1469+a, gdbSNP:373814749
1473+c, tdbSNP:376395087
1484+a, gdbSNP:371274223
1488..1490+, tctdbSNP:201679232
1547+dbSNP:
1547+c, tdbSNP:373098773
1589+c, tdbSNP:377562198
1716+dbSNP:
1716+a, gdbSNP:56365263
1722+c, tdbSNP:367724153
1821+dbSNP:
1821+a, gdbSNP:147713481
1845+dbSNP:
1845+c, tdbSNP:200022569
1934+a, cdbSNP:368860135
1953+a, gdbSNP:201758727
1963+c, tdbSNP:201149414
1969+a, gdbSNP:376245572
1972+a, gdbSNP:369266668
1974+g, tdbSNP:191397480
1984+a, gdbSNP:373758248
1986+c, tdbSNP:376747132
2003+c, tdbSNP:369398098
2010+a, tdbSNP:373479229
complement(2019)-dbSNP:
complement(2019)-g, adbSNP:786906
2074+c, tdbSNP:373655576
2081+c, gdbSNP:377246617
2205+dbSNP:
2205+a, gdbSNP:372278347
2226+c, tdbSNP:200217727
2227+c, tdbSNP:368473517
2246+a, gdbSNP:371912104
2278+dbSNP:
2278+c, tdbSNP:373058309
2286+a, gdbSNP:201749502
2306+a, gdbSNP:12085658
2310+g, tdbSNP:373212914
2312+g, tdbSNP:376189560
2352+a, gdbSNP:6671949
2356+dbSNP:
2356+c, tdbSNP:200476994
2379+a, tdbSNP:377511914
2437+a, gdbSNP:371052905
2448+dbSNP:
2448+g, tdbSNP:368655957
2471+a, gdbSNP:371286273
2478+a, gdbSNP:199566133
2485+a, gdbSNP:375403448
2508+c, tdbSNP:367761410
2595+g, tdbSNP:200519077
2679+dbSNP:
2679+g, tdbSNP:369174463
2731+dbSNP:
2731+a, gdbSNP:373246980
2869+dbSNP:
2869+c, tdbSNP:369061418
2985+dbSNP:
2985+c, tdbSNP:76430567
3001+a, gdbSNP:370637742
3037+dbSNP:
3037+c, tdbSNP:374663309
3051+c, tdbSNP:368751411
3067+a, gdbSNP:201403675
3070+a, gdbSNP:370300406
3092+a, gdbSNP:188265897
3185+a, gdbSNP:200518024
3194+c, tdbSNP:368185560
3195+c, tdbSNP:193170277
3204+a, gdbSNP:377094068
3231+a, cdbSNP:371640614
3242+c, tdbSNP:200905692
3243+a, gdbSNP:374868325
3289+c, tdbSNP:184754507
3339+c, gdbSNP:372351771
3397..3399+, ttgdbSNP:148906887
3408..3410+, gttdbSNP:374016964
3418+a, gdbSNP:187904669
complement(3456..3458)-, aagdbSNP:3831022
3497+c, tdbSNP:76669528
complement(3518)-t, cdbSNP:147551533
complement(3539)-g, adbSNP:141963409
3561+g, tdbSNP:145835594
3595+a, gdbSNP:11541543
3676+a, gdbSNP:151165483
3715+a, cdbSNP:191409712
3759..3760+, tdbSNP:199950121
3766..3767+, adbSNP:142129138
3766+a, tdbSNP:183934392
3767+a, tdbSNP:57445331
3775..3776+, adbSNP:397960600
3821+g, tdbSNP:79463875
3837+a, tdbSNP:181363261
3878+c, gdbSNP:150349508
3997+a, cdbSNP:11541544
4017+g, tdbSNP:61118957
complement(4041)-t, cdbSNP:138057302
4148+a, tdbSNP:115260590
4163+a, gdbSNP:375207517
4176+a, gdbSNP:12027005
4233+a, gdbSNP:76442107
4252+g, tdbSNP:184959864
4431+g, tdbSNP:201266373
4532+a, gdbSNP:370300351
4619+c, tdbSNP:76107017
4749+a, tdbSNP:74392918
4844+g, tdbSNP:79294200
4986+c, tdbSNP:149526423
5065+a, gdbSNP:373003994
5109+a, gdbSNP:189841196
5206+a, tdbSNP:144889137
5235+a, gdbSNP:181568060
5259+c, gdbSNP:186252655
5289+c, g, tdbSNP:786912
5290+a, gdbSNP:138185887
5311+, tdbSNP:34982854
5346..5348+, agadbSNP:201147667
5397+a, gdbSNP:370415100
5409+a, tdbSNP:11800810
5413+a, gdbSNP:146070743
5437+g, tdbSNP:148737509
5481..5484+, tgtadbSNP:200537391
5484..5487+, atgtdbSNP:376692067
5595+c, tdbSNP:141492534
6013+c, tdbSNP:371031954
6059+g, tdbSNP:191056745
6101+a, gdbSNP:376458970
Gene SymbolPKN2
Gene SynonymPak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
Chromosome1
Locus Map1p22.2
Title Common genetic variation at the IL1RL1 locus regulates IL-33/ST2 signaling .
Author Ho JE, Chen WY, Chen MH, Larson MG, McCabe EL, Cheng S, Ghorbani A, Coglianese E, Emilsson V, Johnson AD, Walter S, Franceschini N, O'Donnell CJ, Dehghan A, Lu C, Levy D, Newton-Cheh C, Lin H, Felix JF, Schreiter ER, Vasan RS, Januzzi JL, Lee RT and Wang TJ.
Journal J. Clin. Invest. 123 (10), 4208-4218 (2013)
Title Genome-wide association study of periodontal pathogen colonization .
Author Divaris K, Monda KL, North KE, Olshan AF, Lange EM, Moss K, Barros SP, Beck JD and Offenbacher S.
Journal J. Dent. Res. 91 (7 SUPPL), 21S-28S (2012)
Title Regulation of protein kinase C-related protein kinase 2 (PRK2) by an intermolecular PRK2-PRK2 interaction mediated by Its N-terminal domain .
Author Bauer AF, Sonzogni S, Meyer L, Zeuzem S, Piiper A, Biondi RM and Neimanis S.
Journal J. Biol. Chem. 287 (24), 20590-20602 (2012)
Title Destabilization of PDK1 by Hsp90 inactivation suppresses hepatitis .
Author Kim MG, Moon JS, Kim EJ, Lee SH and Oh JW.
Journal Biochem. Biophys. Res. Commun. 421 (1), 112-118 (2012)
Title Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma .
Author Chambers JC, Zhang W, Sehmi J, Li X, Wass MN, Van der Harst P, Holm H, Sanna S, Kavousi M, Baumeister SE, Coin LJ, Deng G, Gieger C, Heard-Costa NL, Hottenga JJ, Kuhnel B, Kumar V, Lagou V, Liang L, Luan J, Vidal PM, Mateo Leach I, O'Reilly PF, Peden JF, Rahmioglu N, Soininen P, Speliotes EK, Yuan X, Thorleifsson G, Alizadeh BZ, Atwood LD, Borecki IB, Brown MJ, Charoen P, Cucca F, Das D, de Geus EJ, Dixon AL, Doring A, Ehret G, Eyjolfsson GI, Farrall M, Forouhi NG, Friedrich N, Goessling W, Gudbjartsson DF, Harris TB, Hartikainen AL, Heath S, Hirschfield GM, Hofman A, Homuth G, Hypponen E, Janssen HL, Johnson T, Kangas AJ, Kema IP, Kuhn JP, Lai S, Lathrop M, Lerch MM, Li Y, Liang TJ, Lin JP, Loos RJ, Martin NG, Moffatt MF, Montgomery GW, Munroe PB, Musunuru K, Nakamura Y, O'Donnell CJ, Olafsson I, Penninx BW, Pouta A, Prins BP, Prokopenko I, Puls R, Ruokonen A, Savolainen MJ, Schlessinger D, Schouten JN, Seedorf U, Sen-Chowdhry S, Siminovitch KA, Smit JH, Spector TD, Tan W, Teslovich TM, Tukiainen T, Uitterlinden AG, Van der Klauw MM, Vasan RS, Wallace C, Wallaschofski H, Wichmann HE, Willemsen G, Wurtz P, Xu C, Yerges-Armstrong LM, Abecasis GR, Ahmadi KR, Boomsma DI, Caulfield M, Cookson WO, van Duijn CM, Froguel P, Matsuda K, McCarthy MI, Meisinger C, Mooser V, Pietilainen KH, Schumann G, Snieder H, Sternberg MJ, Stolk RP, Thomas HC, Thorsteinsdottir U, Uda M, Waeber G, Wareham NJ, Waterworth DM, Watkins H, Whitfield JB, Witteman JC, Wolffenbuttel BH, Fox CS, Ala-Korpela M, Stefansson K, Vollenweider P, Volzke H, Schadt EE, Scott J, Jarvelin MR, Elliott P and Kooner JS.
Journal Nat. Genet. 43 (11), 1131-1138 (2011)
Title Isolation and characterization of a structural homologue of human PRK2 from rat liver. Distinguishing substrate and lipid activator specificities .
Author Yu W, Liu J, Morrice NA and Wettenhall RE.
Journal J. Biol. Chem. 272 (15), 10030-10034 (1997)
Title The PRK2 kinase is a potential effector target of both Rho and Rac GTPases and regulates actin cytoskeletal organization .
Author Vincent S and Settleman J.
Journal Mol. Cell. Biol. 17 (4), 2247-2256 (1997)
Title Isolation of a NCK-associated kinase, PRK2, an SH3-binding protein and potential effector of Rho protein signaling .
Author Quilliam LA, Lambert QT, Mickelson-Young LA, Westwick JK, Sparks AB, Kay BK, Jenkins NA, Gilbert DJ, Copeland NG and Der CJ.
Journal J. Biol. Chem. 271 (46), 28772-28776 (1996)
Title Cloning and expression patterns of two members of a novel protein-kinase-C-related kinase family .
Author Palmer RH, Ridden J and Parker PJ.
Journal Eur. J. Biochem. 227 (1-2), 344-351 (1995)
Title Identification of multiple, novel, protein kinase C-related gene products .
Author Palmer RH, Ridden J and Parker PJ.
Journal FEBS Lett. 356 (1), 5-8 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.