• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_006297 Homo sapiens X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1), mRNA. GenEZ ORF Cloning In-stock $639.00 $590.00 15

*Business Day

Related Services

RefSeq Version NM_006297.2, 190684674
Length 2102 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1), mRNA.
Product DNA repair protein XRCC1
Comment

Summary: The protein encoded by this gene is involved in the efficient repair of DNA single-strand breaks formed by exposure to ionizing radiation and alkylating agents. This protein interacts with DNA ligase III, polymerase beta and poly (ADP-ribose) polymerase to participate in the base excision repair pathway. It may play a role in DNA processing during meiogenesis and recombination in germ cells. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity. [provided by RefSeq, Jul 2008].

RefSeq NP_006288.2
CDS 121..2022
Misc Feature(1)121..573
Misc Feature(2)121..573
Misc Feature(3)538..540
Misc Feature(4)712..714
Misc Feature(5)715..717
Misc Feature(6)724..726
Misc Feature(7)730..732
Misc Feature(8)751..753
Misc Feature(9)796..798
Misc Feature(10)841..843
Misc Feature(11)889..891
Misc Feature(12)895..897
Misc Feature(13)916..918
Misc Feature(14)1084..1287
Misc Feature(15)order(1126..1128,1138..1140,1147..1149,1156..1158,
Misc Feature(16)1231..1233
Misc Feature(17)order(1273..1275,1285..1287)
Misc Feature(18)<1336..1734
Misc Feature(19)1342..1344
Misc Feature(20)1345..1347
Misc Feature(21)1348..1350
Misc Feature(22)1366..1368
Misc Feature(23)1372..1374
Misc Feature(24)1381..1383
Misc Feature(25)1456..1458
Misc Feature(26)1459..1461
Misc Feature(27)1477..1479
Misc Feature(28)1489..1491
Misc Feature(29)1501..1503
Misc Feature(30)1573..1575
Misc Feature(31)1582..1584
Misc Feature(32)1672..1674
Misc Feature(33)1675..1677
Misc Feature(34)1687..1689
Misc Feature(35)1753..1965
Misc Feature(36)order(1798..1800,1810..1812,1819..1821,1828..1830,
Misc Feature(37)order(1951..1953,1963..1965)
Exon (1)1..171
Gene:XRCC1
Gene Synonym:RCC
Exon (2)172..264
Gene:XRCC1
Gene Synonym:RCC
Exon (3)265..375
Gene:XRCC1
Gene Synonym:RCC
Exon (4)376..534
Gene:XRCC1
Gene Synonym:RCC
Exon (5)535..609
Gene:XRCC1
Gene Synonym:RCC
Exon (6)610..721
Gene:XRCC1
Gene Synonym:RCC
Exon (7)722..831
Gene:XRCC1
Gene Synonym:RCC
Exon (8)832..943
Gene:XRCC1
Gene Synonym:RCC
Exon (9)944..1202
Gene:XRCC1
Gene Synonym:RCC
Exon (10)1203..1319
Gene:XRCC1
Gene Synonym:RCC
Exon (11)1320..1413
Gene:XRCC1
Gene Synonym:RCC
Exon (12)1414..1546
Gene:XRCC1
Gene Synonym:RCC
Exon (13)1547..1601
Gene:XRCC1
Gene Synonym:RCC
Exon (14)1602..1741
Gene:XRCC1
Gene Synonym:RCC
Exon (15)1742..1832
Gene:XRCC1
Gene Synonym:RCC
Exon (16)1833..1908
Gene:XRCC1
Gene Synonym:RCC
Exon (17)1909..2102
Gene:XRCC1
Gene Synonym:RCC
Translation MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDI GNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAA AEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDE SANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQE SPKGKRKLDLNQEEKKTPSKPPAQLSPSVPKRPKLPAPTRTPATAPVPARAQGAVTGKPR GEGTEPRRPRAGPEELGKILQGVVVVLSGFQNPFRSELRDKALELGAKYRPDWTRDSTHL ICAFANTPKYSQVLGLGGRIVRKEWVLDCHRMRRRLPSQRYLMAGPGSSSEEDEASHSGG SGDEAPKLPQKQPQTKTKPTQAAGPSSPQKPPTPEETKAASPVLQEDIDIEGVQSEGQDN GAEDSGDTEDELRRVAEQKEHRLPPGQEENGEDPYAGSTDENTDSEEHQEPPDLPVPELP DFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDYMSDRVQFVITAQEWDPSFEEALMD NPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(38)-dbSNP:
complement(38)-g, cdbSNP:188762977
44+c, tdbSNP:3213245
57+c, tdbSNP:3213246
complement(57)-g, adbSNP:386580956
complement(75)-t, cdbSNP:371553198
complement(80)-g, cdbSNP:55742768
complement(120)-t, cdbSNP:2307187
complement(120)-t, cdbSNP:386564587
complement(134)-g, adbSNP:11553659
complement(134)-g, adbSNP:386519152
complement(140)-t, g, cdbSNP:2307186
148+a, gdbSNP:2307171
complement(148)-t, cdbSNP:386564583
complement(153)-g, adbSNP:150736509
complement(188)-dbSNP:
complement(188)-t, cdbSNP:368913835
complement(200)-g, cdbSNP:372675496
complement(209)-t, cdbSNP:143205267
complement(246)-c, adbSNP:2307189
complement(246)-c, adbSNP:386564588
270..271+dbSNP:
270..271+a, tdbSNP:25495
270+a, gdbSNP:2307174
288+c, tdbSNP:2307185
complement(322)-t, cdbSNP:199589749
complement(335)-t, cdbSNP:25496
354+c, tdbSNP:41558313
complement(355)-t, cdbSNP:148471252
complement(365)-t, cdbSNP:201889748
complement(373)-t, cdbSNP:370972033
complement(390)-dbSNP:
complement(390)-g, adbSNP:376098255
complement(404)-t, gdbSNP:200146769
complement(411)-g, c, adbSNP:200376594
complement(439)-g, adbSNP:144559135
440+a, gdbSNP:2228487
complement(440)-g, adbSNP:386561693
complement(448)-t, cdbSNP:138838954
complement(467)-g, adbSNP:150213223
complement(472)-g, adbSNP:143881845
complement(481)-t, cdbSNP:138284081
complement(483)-g, adbSNP:369088619
complement(490)-g, adbSNP:200222662
complement(491)-t, cdbSNP:373454964
complement(499)-g, adbSNP:199854803
complement(501)-t, cdbSNP:147024878
complement(509)-g, adbSNP:369880593
complement(519)-g, cdbSNP:368911719
complement(529)-t, cdbSNP:141859304
complement(542)-dbSNP:
complement(542)-g, adbSNP:267605526
complement(562)-g, adbSNP:374486126
complement(589)-g, adbSNP:2307180
complement(589)-g, adbSNP:386564585
594+a, tdbSNP:2307168
complement(602)-t, cdbSNP:2307191
complement(602)-t, cdbSNP:386564589
complement(603)-t, cdbSNP:149187925
complement(610)-dbSNP:
complement(610)-t, gdbSNP:145528895
complement(640)-g, adbSNP:143266865
complement(641)-t, cdbSNP:139834892
complement(654)-t, cdbSNP:377599064
complement(658)-t, cdbSNP:373804974
complement(663)-g, adbSNP:146426015
complement(664)-t, cdbSNP:190563109
complement(668)-t, cdbSNP:56357789
complement(690)-g, cdbSNP:2307170
700+c, tdbSNP:1799782
complement(700)-g, adbSNP:386545546
717+c, tdbSNP:2307192
complement(720)-t, gdbSNP:201283474
complement(737)-dbSNP:
complement(737)-g, adbSNP:368767486
738+a, c, g, tdbSNP:915927
complement(742)-t, cdbSNP:375595185
complement(761)-g, adbSNP:111857343
complement(790)-c, adbSNP:148663339
complement(808)-t, gdbSNP:371688474
complement(817)-t, cdbSNP:368837757
complement(836)-dbSNP:
complement(836)-t, cdbSNP:368965282
complement(881)-t, cdbSNP:374247969
complement(882)-t, cdbSNP:200575088
complement(915)-t, cdbSNP:147282758
complement(938)-g, adbSNP:143917286
959+dbSNP:
959+a, gdbSNP:25489
complement(971)-g, adbSNP:146168662
complement(988)-g, adbSNP:369764483
complement(999)-c, adbSNP:201296138
1014+a, cdbSNP:2307188
complement(1019)-t, cdbSNP:200528601
1020+a, gdbSNP:3213366
complement(1030)-g, adbSNP:25490
complement(1037)-g, adbSNP:368291115
complement(1042)-g, adbSNP:200894967
complement(1045)-t, cdbSNP:25491
complement(1045)-g, adbSNP:386569337
complement(1048)-g, adbSNP:375143036
1098+g, tdbSNP:2307173
complement(1102)-t, cdbSNP:377373496
complement(1128)-g, adbSNP:201954068
complement(1132)-g, adbSNP:371095487
complement(1136)-t, cdbSNP:377566281
complement(1150)-t, cdbSNP:373455435
complement(1152)-t, cdbSNP:369440040
complement(1169)-t, cdbSNP:376249360
complement(1193)-g, adbSNP:372782938
complement(1198)-g, adbSNP:374382686
complement(1209)-dbSNP:
complement(1209)-g, adbSNP:145754145
complement(1214)-g, adbSNP:140908193
complement(1234)-g, adbSNP:376615629
complement(1256)-t, cdbSNP:372371308
complement(1257)-g, adbSNP:368206391
complement(1261)-t, cdbSNP:2271980
complement(1265)-t, cdbSNP:146443634
complement(1274)-t, cdbSNP:201607078
complement(1279)-g, cdbSNP:144007095
complement(1281)-t, cdbSNP:199613843
complement(1282)-t, cdbSNP:200332207
complement(1285)-g, adbSNP:148817735
complement(1297)-g, adbSNP:375801765
complement(1298)-t, cdbSNP:200842482
complement(1309)-t, gdbSNP:201337051
complement(1315)-g, adbSNP:199739076
1316+a, gdbSNP:25487
complement(1316)-t, cdbSNP:386493716
complement(1341)-dbSNP:
complement(1341)-t, adbSNP:2307179
complement(1374)-g, adbSNP:2293035
complement(1384)-t, cdbSNP:371113463
complement(1406)-g, adbSNP:199761694
complement(1434)-dbSNP:
complement(1434)-c, adbSNP:369052406
complement(1460)-g, adbSNP:374994600
complement(1523)-g, adbSNP:376540134
complement(1534)-g, cdbSNP:370026016
complement(1550)-dbSNP:
complement(1550)-t, cdbSNP:371008718
complement(1566)-t, cdbSNP:368774314
complement(1569)-t, cdbSNP:374553812
1574+a, cdbSNP:2307184
complement(1574)-c, adbSNP:386564586
1591+a, gdbSNP:72554204
complement(1607)-dbSNP:
complement(1607)-g, adbSNP:373825054
complement(1637)-g, cdbSNP:139599857
complement(1661)-t, cdbSNP:386569321
1661+c, tdbSNP:25474
complement(1662)-t, cdbSNP:201452576
complement(1665)-g, adbSNP:145204208
complement(1673)-g, adbSNP:139998857
complement(1676)-g, adbSNP:201595223
complement(1683)-t, cdbSNP:377436010
complement(1689)-g, cdbSNP:374398701
1702+c, tdbSNP:41561817
complement(1734)-g, cdbSNP:147480146
complement(1741)-g, cdbSNP:369974548
complement(1795)-dbSNP:
complement(1795)-g, adbSNP:199748521
1796+a, gdbSNP:2307167
complement(1796)-t, cdbSNP:386564582
1798+c, tdbSNP:2307166
1806+c, gdbSNP:2307181
complement(1815)-g, adbSNP:144412719
1833+dbSNP:
1833+a, gdbSNP:2307182
complement(1839)-g, adbSNP:200053544
complement(1846..1847)-tt, gadbSNP:386809580
1846+a, tdbSNP:2682557
1847..1848+, ctdbSNP:368976870
complement(1847)-c, adbSNP:2307177
complement(1849)-t, gdbSNP:368496910
complement(1858)-g, adbSNP:140655170
complement(1899)-g, cdbSNP:148611340
complement(1942)-dbSNP:
complement(1942)-g, adbSNP:199876205
complement(1943)-t, cdbSNP:145342527
complement(2012)-g, adbSNP:201967712
complement(2013)-c, adbSNP:377033786
complement(2016)-t, cdbSNP:3547
complement(2034..2035)-, gtdbSNP:60624677
complement(2035..2048)-, gtgtgtgtgtgtgtdbSNP:45592142
complement(2035..2036)-, gtdbSNP:367748545
complement(2035..2036)-, gtdbSNP:386389062
complement(2036)-g, adbSNP:11553654
2050+a, c, gdbSNP:2307172
complement(2059..2072)-, gtgtgtgtgtgtgtdbSNP:145135970
complement(2062)-t, gdbSNP:368414217
complement(2064)-g, adbSNP:371600613
complement(2069..2072)-, gtgtdbSNP:72484243
2070..2071+(ca)12, 17, 18, 19, 20, 21, 22, 24dbSNP:3220637
complement(2072..2073)-, gtdbSNP:141718622
Gene SymbolXRCC1
Gene SynonymRCC
Chromosome19
Locus Map19q13.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006297 Homo sapiens X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1), mRNA. In-stock $639.00 $590.00 15
Title Association of XRCC1 genetic polymorphism (Arg399Gln) with laryngeal cancer: a meta-analysis based on 4,031 subjects .
Author Chen W, Wang ZY, Xu FL, Wu KM, Zhang Y, Xu L and Wang QP.
Journal Tumour Biol. 35 (2), 1637-1640 (2014)
Title Association of XRCC1 Arg399Gln polymorphism with bladder cancer susceptibility: a meta-analysis .
Author Yang D, Liu C, Shi J, Wang N, Du X, Yin Q and Wang Y.
Journal Gene 534 (1), 17-23 (2014)
Title XRCC1 R399Q polymorphism and risk of normal tissue injury after radiotherapy in breast cancer patients .
Author Zhou Y, Zhou W, Liu Q, Fan Z, Yang Z, Tu Q, Li L and Liu H.
Journal Tumour Biol. 35 (1), 21-25 (2014)
Title Meta-analysis of genetic polymorphisms and ophthalmologic disease risk in Asian populations: a case of DNA repair XRCC1 gene .
Author Saki N, Galehdari H, Feghhi M, Larijani FA and Rahim F.
Journal Pak. J. Biol. Sci. 16 (21), 1226-1237 (2013)
Title Lys751Gln XPD and Arg399Gln XRCC1 in Romanians. Association with sporadic colorectal cancer risk and different stages of carcinomas .
Author Procopciuc,L.M. and Osian,G.
Journal Chirurgia (Bucur) 108 (5), 711-718 (2013)
Title Simultaneous amplification of four DNA repair genes and beta-actin in human lymphocytes by multiplex reverse transcriptase-PCR .
Author Wei Q, Xu X, Cheng L, Legerski RJ and Ali-Osman F.
Journal Cancer Res. 55 (21), 5025-5029 (1995)
Title Genomic sequence comparison of the human and mouse XRCC1 DNA repair gene regions .
Author Lamerdin JE, Montgomery MA, Stilwagen SA, Scheidecker LK, Tebbs RS, Brookman KW, Thompson LH and Carrano AV.
Journal Genomics 25 (2), 547-554 (1995)
Title The 1993-94 Genethon human genetic linkage map .
Author Gyapay G, Morissette J, Vignal A, Dib C, Fizames C, Millasseau P, Marc S, Bernardi G, Lathrop M and Weissenbach J.
Journal Nat. Genet. 7 (2 SPEC NO), 246-339 (1994)
Title Molecular cloning of the human XRCC1 gene, which corrects defective .
Author Thompson LH, Brookman KW, Jones NJ, Allen SA and Carrano AV.
Journal Mol. Cell. Biol. 10 (12), 6160-6171 (1990)
Title Complementation of repair gene mutations on the hemizygous chromosome 9 in CHO: a third repair gene on human chromosome 19 .
Author Thompson LH, Bachinski LL, Stallings RL, Dolf G, Weber CA, Westerveld A and Siciliano MJ.
Journal Genomics 5 (4), 670-679 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.