• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_006297 Homo sapiens X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1), mRNA. GenEZ ORF Cloning In-stock $639.00 $590.00 15

*Business Day

Related Services

RefSeq Version NM_006297.2, 190684674
Length 2102 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1), mRNA.
Product DNA repair protein XRCC1
Comment

Summary: The protein encoded by this gene is involved in the efficient repair of DNA single-strand breaks formed by exposure to ionizing radiation and alkylating agents. This protein interacts with DNA ligase III, polymerase beta and poly (ADP-ribose) polymerase to participate in the base excision repair pathway. It may play a role in DNA processing during meiogenesis and recombination in germ cells. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity. [provided by RefSeq, Jul 2008].

RefSeq NP_006288.2
CDS 121..2022
Misc Feature(1)121..573
Misc Feature(2)121..573
Misc Feature(3)538..540
Misc Feature(4)712..714
Misc Feature(5)715..717
Misc Feature(6)724..726
Misc Feature(7)730..732
Misc Feature(8)751..753
Misc Feature(9)796..798
Misc Feature(10)841..843
Misc Feature(11)889..891
Misc Feature(12)895..897
Misc Feature(13)916..918
Misc Feature(14)1084..1287
Misc Feature(15)order(1126..1128,1138..1140,1147..1149,1156..1158,
Misc Feature(16)1231..1233
Misc Feature(17)order(1273..1275,1285..1287)
Misc Feature(18)1342..1344
Misc Feature(19)1345..1347
Misc Feature(20)1348..1350
Misc Feature(21)1366..1368
Misc Feature(22)1372..1374
Misc Feature(23)1381..1383
Misc Feature(24)1456..1458
Misc Feature(25)1459..1461
Misc Feature(26)1477..1479
Misc Feature(27)1489..1491
Misc Feature(28)1501..1503
Misc Feature(29)1573..1575
Misc Feature(30)1582..1584
Misc Feature(31)1672..1674
Misc Feature(32)1675..1677
Misc Feature(33)1687..1689
Misc Feature(34)1753..1965
Misc Feature(35)order(1798..1800,1810..1812,1819..1821,1828..1830,
Misc Feature(36)order(1951..1953,1963..1965)
Exon (1)1..171
Gene:XRCC1
Gene Synonym:RCC
Exon (2)172..264
Gene:XRCC1
Gene Synonym:RCC
Exon (3)265..375
Gene:XRCC1
Gene Synonym:RCC
Exon (4)376..534
Gene:XRCC1
Gene Synonym:RCC
Exon (5)535..609
Gene:XRCC1
Gene Synonym:RCC
Exon (6)610..721
Gene:XRCC1
Gene Synonym:RCC
Exon (7)722..831
Gene:XRCC1
Gene Synonym:RCC
Exon (8)832..943
Gene:XRCC1
Gene Synonym:RCC
Exon (9)944..1202
Gene:XRCC1
Gene Synonym:RCC
Exon (10)1203..1319
Gene:XRCC1
Gene Synonym:RCC
Exon (11)1320..1413
Gene:XRCC1
Gene Synonym:RCC
Exon (12)1414..1546
Gene:XRCC1
Gene Synonym:RCC
Exon (13)1547..1601
Gene:XRCC1
Gene Synonym:RCC
Exon (14)1602..1741
Gene:XRCC1
Gene Synonym:RCC
Exon (15)1742..1832
Gene:XRCC1
Gene Synonym:RCC
Exon (16)1833..1908
Gene:XRCC1
Gene Synonym:RCC
Exon (17)1909..2102
Gene:XRCC1
Gene Synonym:RCC
Translation MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDI GNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAA AEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDE SANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQE SPKGKRKLDLNQEEKKTPSKPPAQLSPSVPKRPKLPAPTRTPATAPVPARAQGAVTGKPR GEGTEPRRPRAGPEELGKILQGVVVVLSGFQNPFRSELRDKALELGAKYRPDWTRDSTHL ICAFANTPKYSQVLGLGGRIVRKEWVLDCHRMRRRLPSQRYLMAGPGSSSEEDEASHSGG SGDEAPKLPQKQPQTKTKPTQAAGPSSPQKPPTPEETKAASPVLQEDIDIEGVQSEGQDN GAEDSGDTEDELRRVAEQKEHRLPPGQEENGEDPYAGSTDENTDSEEHQEPPDLPVPELP DFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDYMSDRVQFVITAQEWDPSFEEALMD NPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(38)-dbSNP:
complement(38)-g, cdbSNP:188762977
complement(44)-t, cdbSNP:3213245
complement(57)-t, cdbSNP:3213246
complement(64..65)-, gdbSNP:67928538
complement(80)-g, cdbSNP:55742768
complement(120)-t, cdbSNP:2307187
complement(134)-g, adbSNP:11553659
complement(140)-t, g, cdbSNP:2307186
complement(148)-g, adbSNP:2307171
complement(153)-g, adbSNP:150736509
complement(209)-dbSNP:
complement(209)-t, cdbSNP:143205267
complement(246)-c, adbSNP:2307189
complement(270)-dbSNP:
complement(270)-g, adbSNP:2307174
complement(271)-t, adbSNP:25495
complement(288)-t, cdbSNP:2307185
complement(322)-t, cdbSNP:199589749
complement(335)-t, cdbSNP:25496
complement(354)-t, cdbSNP:41558313
complement(355)-t, cdbSNP:148471252
complement(365)-t, cdbSNP:201889748
complement(404)-dbSNP:
complement(404)-t, gdbSNP:200146769
complement(411)-g, adbSNP:200376594
complement(439)-g, adbSNP:144559135
complement(440)-g, adbSNP:2228487
complement(448)-t, cdbSNP:138838954
complement(467)-g, adbSNP:150213223
complement(472)-g, adbSNP:143881845
complement(474..475)-, cdbSNP:66642689
complement(481)-t, cdbSNP:138284081
complement(490)-g, adbSNP:200222662
complement(499)-g, adbSNP:199854803
complement(501)-t, cdbSNP:147024878
complement(529)-t, cdbSNP:141859304
complement(589)-dbSNP:
complement(589)-g, adbSNP:2307180
complement(594)-t, adbSNP:2307168
complement(602)-t, cdbSNP:2307191
complement(603)-t, cdbSNP:149187925
complement(610)-dbSNP:
complement(610)-t, gdbSNP:145528895
complement(640)-g, adbSNP:143266865
complement(641)-t, cdbSNP:139834892
complement(663)-g, adbSNP:146426015
complement(664)-t, cdbSNP:190563109
complement(668)-t, cdbSNP:56357789
complement(690)-g, cdbSNP:2307170
complement(700)-t, cdbSNP:1799782
complement(717)-t, cdbSNP:2307192
complement(720)-t, gdbSNP:201283474
complement(738)-dbSNP:
complement(738)-t, g, c, adbSNP:915927
complement(761)-g, adbSNP:111857343
complement(790)-c, adbSNP:148663339
complement(882)-dbSNP:
complement(882)-t, cdbSNP:200575088
complement(915)-t, cdbSNP:147282758
complement(938)-g, adbSNP:143917286
complement(959)-dbSNP:
complement(959)-g, adbSNP:25489
complement(971)-g, adbSNP:146168662
complement(983)-g, adbSNP:149342135
complement(999)-c, adbSNP:201296138
complement(1014)-c, adbSNP:2307188
complement(1019)-t, cdbSNP:200528601
complement(1020)-g, adbSNP:3213366
complement(1030)-g, adbSNP:25490
complement(1042)-g, adbSNP:200894967
complement(1045)-t, cdbSNP:25491
complement(1098)-t, gdbSNP:2307173
complement(1128)-g, adbSNP:201954068
complement(1209)-dbSNP:
complement(1209)-g, adbSNP:145754145
complement(1214)-g, adbSNP:140908193
complement(1261)-t, cdbSNP:2271980
complement(1265)-t, cdbSNP:146443634
complement(1274)-t, cdbSNP:201607078
complement(1279)-g, cdbSNP:144007095
complement(1281)-t, cdbSNP:199613843
complement(1282)-t, cdbSNP:200332207
complement(1285)-g, adbSNP:148817735
complement(1298)-t, cdbSNP:200842482
complement(1309)-t, gdbSNP:201337051
complement(1315)-g, adbSNP:199739076
complement(1316)-g, adbSNP:25487
complement(1341)-dbSNP:
complement(1341)-t, adbSNP:2307179
complement(1374)-g, adbSNP:2293035
complement(1406)-g, adbSNP:199761694
complement(1574)-dbSNP:
complement(1574)-c, adbSNP:2307184
complement(1591)-g, adbSNP:72554204
complement(1637)-dbSNP:
complement(1637)-g, cdbSNP:139599857
complement(1661)-t, cdbSNP:25474
complement(1662)-t, cdbSNP:201452576
complement(1665)-g, adbSNP:145204208
complement(1673)-g, adbSNP:139998857
complement(1676)-g, adbSNP:201595223
complement(1702)-t, cdbSNP:41561817
complement(1734)-g, cdbSNP:147480146
complement(1795)-dbSNP:
complement(1795)-g, adbSNP:199748521
complement(1796)-g, adbSNP:2307167
complement(1798)-t, cdbSNP:2307166
complement(1806)-g, cdbSNP:2307181
complement(1815)-g, adbSNP:144412719
complement(1833)-dbSNP:
complement(1833)-g, adbSNP:2307182
complement(1839)-g, adbSNP:200053544
complement(1846)-t, adbSNP:2682557
complement(1847)-c, adbSNP:2307177
complement(1858)-g, adbSNP:140655170
complement(1899)-g, cdbSNP:148611340
complement(1924)-dbSNP:
complement(1924)-t, gdbSNP:137950555
complement(1942)-g, adbSNP:199876205
complement(1943)-t, cdbSNP:145342527
complement(2012)-g, adbSNP:201967712
complement(2016)-t, cdbSNP:3547
complement(2034..2035)-, gtdbSNP:60624677
complement(2034)-, tadbSNP:2307169
complement(2036)-g, adbSNP:11553654
complement(2049..2062)-, gtgtgtgtgtgtgtdbSNP:45592142
complement(2050)-g, c, adbSNP:2307172
complement(2059..2072)-, gtgtgtgtgtgtgtdbSNP:145135970
complement(2059..2068)-, gtgtgtgtgtdbSNP:72212037
complement(2068..2071)-, tgtgdbSNP:71910581
complement(2069..2072)-, gtgtdbSNP:72484243
complement(2069..2070)-, gtgtgtdbSNP:72117203
complement(2071..2072)-, gtdbSNP:66940040
complement(2072..2073)-, gtdbSNP:141718622
Gene SymbolXRCC1
Gene SynonymRCC
Chromosome19
Locus Map19q13.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006297 Homo sapiens X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1), mRNA. In-stock $639.00 $590.00 15
Title Association of XRCC1 gene polymorphisms with the survival and clinicopathological characteristics of gastric cancer .
Author Zhang,Y., Wang,M., Gu,D., Wu,D., Zhang,X., Gong,W., Tan,Y., Zhou,J., Wu,X., Tang,C., Zhang,Z. and Chen,J.
Journal DNA Cell Biol. 32 (3), 111-118 (2013)
Title XRCC1 and GSTP1 polymorphisms and prognosis of oxaliplatin-based chemotherapy in colorectal cancer: a meta-analysis .
Author Ye,F., Liu,Z., Tan,A., Liao,M., Mo,Z. and Yang,X.
Journal Cancer Chemother. Pharmacol. 71 (3), 733-740 (2013)
Title X-ray repair cross-complementing group 1 Arg399Gln gene polymorphism and susceptibility to colorectal cancer:a meta-analysis .
Author Zeng,F.R., Ling,Y., Yang,J., Tian,X.C., Yang,X. and Luo,R.C.
Journal Tumour Biol. 34 (1), 555-563 (2013)
Title XPD and XRCC1 gene polymorphism in patients with normal and abnormal cervical cytology by pap smear .
Author Yilmaz,E., Celik,O., Celik,E., Turkcuoglu,I., Simsek,Y., Karaer,A., Otlu,B., Gulbay,G. and Yesilada,E.
Journal Eur Rev Med Pharmacol Sci 16 (12), 1713-1718 (2012)
Title Lack of an association between the XRCC1 Arg399Gln polymorphism and gastric cancer based on a meta-analysis .
Author Liu,B.M., Liu,T.M., You,B.S., You,H.Y., Yang,J., Li,L. and He,Y.C.
Journal Genet. Mol. Res. 11 (4), 3852-3860 (2012)
Title Simultaneous amplification of four DNA repair genes and beta-actin in human lymphocytes by multiplex reverse transcriptase-PCR .
Author Wei,Q., Xu,X., Cheng,L., Legerski,R.J. and Ali-Osman,F.
Journal Cancer Res. 55 (21), 5025-5029 (1995)
Title Genomic sequence comparison of the human and mouse XRCC1 DNA repair gene regions .
Author Lamerdin,J.E., Montgomery,M.A., Stilwagen,S.A., Scheidecker,L.K., Tebbs,R.S., Brookman,K.W., Thompson,L.H. and Carrano,A.V.
Journal Genomics 25 (2), 547-554 (1995)
Title The 1993-94 Genethon human genetic linkage map .
Author Gyapay,G., Morissette,J., Vignal,A., Dib,C., Fizames,C., Millasseau,P., Marc,S., Bernardi,G., Lathrop,M. and Weissenbach,J.
Journal Nat. Genet. 7 (2 SPEC NO), 246-339 (1994)
Title Molecular cloning of the human XRCC1 gene, which corrects defective .
Author Thompson,L.H., Brookman,K.W., Jones,N.J., Allen,S.A. and Carrano,A.V.
Journal Mol. Cell. Biol. 10 (12), 6160-6171 (1990)
Title Complementation of repair gene mutations on the hemizygous chromosome 9 in CHO: a third repair gene on human chromosome 19 .
Author Thompson,L.H., Bachinski,L.L., Stallings,R.L., Dolf,G., Weber,C.A., Westerveld,A. and Siciliano,M.J.
Journal Genomics 5 (4), 670-679 (1989)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.