• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens aminopeptidase puromycin sensitive (NPEPPS), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_006310 Homo sapiens aminopeptidase puromycin sensitive (NPEPPS), mRNA. GenEZ ORF Cloning On-demand $899.00 20

*Business Day

Related Services

RefSeq Version NM_006310.3, 158937235
Length 4364 bp
Structure linear
Update Date 02-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens aminopeptidase puromycin sensitive (NPEPPS), mRNA.
Product puromycin-sensitive aminopeptidase
Comment

Summary: This gene encodes the puromycin-sensitive aminopeptidase, a zinc metallopeptidase which hydrolyzes amino acids from the N-terminus of its substrate. The protein has been localized to both the cytoplasm and to cellular membranes. This enzyme degrades enkaphalins in the brain, and studies in mouse suggest that it is involved in proteolytic events regulating the cell cycle. [provided by RefSeq, Jul 2008].


CCDS Note: Experimental evidence (N-terminal protein sequencing; PubMed ID 10978616) shows a peptide starting at Pro-46, suggesting that the downstream ATG (coding for Met-45) is used.

RefSeq NP_006301.3
CDS 224..2983
Misc Feature(1)368..2932
Misc Feature(2)368..2932
Misc Feature(3)404..1735
Misc Feature(4)1169..1183
Misc Feature(5)order(1277..1279,1289..1291,1346..1348)
Misc Feature(6)1535..1537
Misc Feature(7)1955..2896
Misc Feature(8)2399..2413
Exon (1)1..478
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (2)479..563
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (3)564..641
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (4)642..763
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (5)764..871
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (6)872..1072
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (7)1073..1169
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (8)1170..1203
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (9)1204..1318
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (10)1319..1483
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (11)1484..1588
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (12)1589..1649
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (13)1650..1759
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (14)1760..1823
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (15)1824..1963
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (16)1964..2098
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (17)2099..2318
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (18)2319..2461
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (19)2462..2518
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (20)2519..2626
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (21)2627..2782
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (22)2783..2830
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (23)2831..4339
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Translation MWLAAAAPSLARRLLFLGPPPPPLLLLVFSRSSRRRLHSLGLAAMPEKRPFERLPADVSP INYSLCLKPDLLDFTFEGKLEAAAQVRQATNQIVMNCADIDIITASYAPEGDEEIHATGF NYQNEDEKVTLSFPSTLQTGTGTLKIDFVGELNDKMKGFYRSKYTTPSGEVRYAAVTQFE ATDARRAFPCWDEPAIKATFDISLVVPKDRVALSNMNVIDRKPYPDDENLVEVKFARTPV MSTYLVAFVVGEYDFVETRSKDGVCVRVYTPVGKAEQGKFALEVAAKTLPFYKDYFNVPY PLPKIDLIAIADFAAGAMENWGLVTYRETALLIDPKNSCSSSRQWVALVVGHELAHQWFG NLVTMEWWTHLWLNEGFASWIEYLCVDHCFPEYDIWTQFVSADYTRAQELDALDNSHPIE VSVGHPSEVDEIFDAISYSKGASVIRMLHDYIGDKDFKKGMNMYLTKFQQKNAATEDLWE SLENASGKPIAAVMNTWTKQMGFPLIYVEAEQVEDDRLLRLSQKKFCAGGSYVGEDCPQW MVPITISTSEDPNQAKLKILMDKPEMNVVLKNVKPDQWVKLNLGTVGFYRTQYSSAMLES LLPGIRDLSLPPVDRLGLQNDLFSLARAGIISTVEVLKVMEAFVNEPNYTVWSDLSCNLG ILSTLLSHTDFYEEIQEFVKDVFSPIGERLGWDPKPGEGHLDALLRGLVLGKLGKAGHKA TLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQADMQEEKNRIE RVLGATLLPDLIQKVLTFALSEEVRPQDTVSVIGGVAGGSKHGRKAAWKFIKDNWEELYN RYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENILLNAAWLKR DAESIHQYLLQRKASPPTV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
149+dbSNP:
149+g, tdbSNP:142358928
341+c, tdbSNP:200065879
411+a, gdbSNP:28482949
442+c, tdbSNP:201212390
489+dbSNP:
489+c, tdbSNP:369570255
571+dbSNP:
571+c, tdbSNP:372808255
646+dbSNP:
646+a, gdbSNP:202147565
703+c, tdbSNP:377685344
712+c, tdbSNP:2661174
929+dbSNP:
929+g, tdbSNP:370952703
932+c, tdbSNP:377728785
950+a, gdbSNP:149179597
1015+a, gdbSNP:374392914
1022+c, tdbSNP:3968300
1066+a, gdbSNP:3968301
1213+dbSNP:
1213+a, gdbSNP:372187657
1250+c, tdbSNP:373998810
1285+c, tdbSNP:2644321
1294+a, gdbSNP:145829042
1323+dbSNP:
1323+a, gdbSNP:376523771
1360+a, cdbSNP:368991051
1473+a, gdbSNP:373465833
1513+dbSNP:
1513+c, tdbSNP:376865977
1521+g, tdbSNP:200616431
1616+dbSNP:
1616+c, tdbSNP:148379754
1691+dbSNP:
1691+a, gdbSNP:200634700
1711+c, tdbSNP:201718491
1726+c, gdbSNP:190795420
1743+a, gdbSNP:200095837
1763+dbSNP:
1763+a, gdbSNP:370170213
1777+a, gdbSNP:199627398
1778+c, tdbSNP:199810184
1789+c, gdbSNP:79778933
1865+dbSNP:
1865+a, gdbSNP:374390998
1954+a, gdbSNP:368315048
1993+dbSNP:
1993+c, gdbSNP:372927934
2003+a, tdbSNP:368712014
2007+c, gdbSNP:371661038
2040+a, gdbSNP:201311692
2051+c, tdbSNP:369245385
2055+c, tdbSNP:148467949
2173+dbSNP:
2173+c, tdbSNP:376563645
2233+a, cdbSNP:369577595
2238+a, tdbSNP:376975784
2245+a, tdbSNP:371362770
2247+c, tdbSNP:374288577
2275+a, tdbSNP:200255738
2277+c, tdbSNP:372571754
2280+c, tdbSNP:200402839
2326+dbSNP:
2326+c, tdbSNP:201093766
2381+a, gdbSNP:368658252
2385+c, tdbSNP:370834075
2402+c, tdbSNP:375012383
2419+c, tdbSNP:372616507
2443+c, tdbSNP:376665760
2567+dbSNP:
2567+a, gdbSNP:373373883
2575+c, tdbSNP:375822602
2576+a, gdbSNP:368913646
2593+c, tdbSNP:372409735
2652+dbSNP:
2652+c, tdbSNP:376103009
2653+a, gdbSNP:187845212
2656+a, gdbSNP:374106378
2789+dbSNP:
2789+c, gdbSNP:375636986
2794+c, gdbSNP:369531389
2840+dbSNP:
2840+c, gdbSNP:34598464
2958+a, gdbSNP:201842079
3007..3008+, gggcdbSNP:149267740
3044+c, tdbSNP:111492806
3066+a, gdbSNP:368206440
3309..3310+, gdbSNP:34314592
3443+a, tdbSNP:149109100
3476+a, gdbSNP:1801416
3487+a, gdbSNP:369565339
3489+, tdbSNP:57585141
3524+a, cdbSNP:190680892
3704+c, tdbSNP:181526426
3819+a, tdbSNP:372371302
3835+c, tdbSNP:17609248
3861+c, tdbSNP:367570351
3895+a, tdbSNP:375614287
3926+c, tdbSNP:17677508
3970+c, tdbSNP:143209825
4034..4035+, aadbSNP:201093336
4081..4082+, ctadbSNP:3065062
4082..4083+, ctadbSNP:71712895
4085+a, cdbSNP:80040289
4105+c, gdbSNP:3809866
4146..4149+, cctadbSNP:148390023
4152+, tdbSNP:199946088
complement(4160)-g, adbSNP:3087904
4221+c, tdbSNP:371805362
4286..4287+, adbSNP:372148163
Gene SymbolNPEPPS
Gene SynonymAAP-S; MP100; PSA
Chromosome17
Locus Map17q21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006310 Homo sapiens aminopeptidase puromycin sensitive (NPEPPS), mRNA. On-demand $899.00 20
XM_006722187 PREDICTED: Homo sapiens aminopeptidase puromycin sensitive (NPEPPS), transcript variant X1, mRNA. On-demand $849.00 20
Title Puromycin-sensitive aminopeptidase (PSA/NPEPPS) impedes development of neuropathology in hPSA/TAU(P301L) double-transgenic mice .
Author Kudo LC, Parfenova L, Ren G, Vi N, Hui M, Ma Z, Lau K, Gray M, Bardag-Gorce F, Wiedau-Pazos M, Hui KS and Karsten SL.
Journal Hum. Mol. Genet. 20 (9), 1820-1833 (2011)
Title Puromycin-sensitive aminopeptidase protects against aggregation-prone proteins via autophagy .
Author Menzies FM, Hourez R, Imarisio S, Raspe M, Sadiq O, Chandraratna D, O'Kane C, Rock KL, Reits E, Goldberg AL and Rubinsztein DC.
Journal Hum. Mol. Genet. 19 (23), 4573-4586 (2010)
Title Involvement of puromycin-sensitive aminopeptidase in proteolysis of tau protein in cultured cells, and attenuated proteolysis of frontotemporal dementia and parkinsonism linked to chromosome 17 (FTDP-17) mutant tau .
Author Yanagi K, Tanaka T, Kato K, Sadik G, Morihara T, Kudo T and Takeda M.
Journal Psychogeriatrics 9 (4), 157-166 (2009)
Title Cobalt chloride-induced downregulation of puromycin-sensitive aminopeptidase suppresses the migration and invasion of PC-3 cells .
Author Lee SH and Kim HG.
Journal J. Microbiol. Biotechnol. 19 (5), 530-536 (2009)
Title Large-scale proteomics and phosphoproteomics of urinary exosomes .
Author Gonzales PA, Pisitkun T, Hoffert JD, Tchapyjnikov D, Star RA, Kleta R, Wang NS and Knepper MA.
Journal J. Am. Soc. Nephrol. 20 (2), 363-379 (2009)
Title cDNA cloning and molecular characterization of human brain metalloprotease MP100: a beta-secretase candidate? .
Author Huber G, Thompson A, Gruninger F, Mechler H, Hochstrasser R, Hauri
Journal J. Neurochem. 72 (3), 1215-1223 (1999)
Title Cloning of the human puromycin-sensitive aminopeptidase and evidence for expression in neurons .
Author Tobler AR, Constam DB, Schmitt-Graff A, Malipiero U, Schlapbach R and Fontana A.
Journal J. Neurochem. 68 (3), 889-897 (1997)
Title Puromycin-sensitive aminopeptidase. Sequence analysis, expression, and functional characterization .
Author Constam DB, Tobler AR, Rensing-Ehl A, Kemler I, Hersh LB and Fontana A.
Journal J. Biol. Chem. 270 (45), 26931-26939 (1995)
Title Immunocytochemical comparison of cultured normal epithelial prostatic cells with prostatic tissue sections .
Author Cussenot O, Berthon P, Cochand-Priollet B, Maitland NJ and Le Duc A.
Journal Exp. Cell Res. 214 (1), 83-92 (1994)
Title Studies on the tissue distribution of the puromycin-sensitive enkephalin-degrading aminopeptidases .
Author McLellan S, Dyer SH, Rodriguez G and Hersh LB.
Journal J. Neurochem. 51 (5), 1552-1559 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.