• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens aminopeptidase puromycin sensitive (NPEPPS), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_006310 Homo sapiens aminopeptidase puromycin sensitive (NPEPPS), mRNA. GenEZ ORF Cloning On-demand $899.00 20

*Business Day

Related Services

RefSeq Version NM_006310.3, 158937235
Length 4364 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens aminopeptidase puromycin sensitive (NPEPPS), mRNA.
Product puromycin-sensitive aminopeptidase
Comment

Summary: This gene encodes the puromycin-sensitive aminopeptidase, a zinc metallopeptidase which hydrolyzes amino acids from the N-terminus of its substrate. The protein has been localized to both the cytoplasm and to cellular membranes. This enzyme degrades enkaphalins in the brain, and studies in mouse suggest that it is involved in proteolytic events regulating the cell cycle. [provided by RefSeq, Jul 2008].


CCDS Note: Experimental evidence (N-terminal protein sequencing; PubMed ID 10978616) shows a peptide starting at Pro-46, suggesting that the downstream ATG (coding for Met-45) is used.

RefSeq NP_006301.3
CDS 224..2983
Misc Feature(1)380..1546
Misc Feature(2)380..1546
Misc Feature(3)404..1735
Misc Feature(4)1169..1183
Misc Feature(5)order(1277..1279,1289..1291,1346..1348)
Misc Feature(6)1535..1537
Misc Feature(7)1955..2896
Misc Feature(8)2399..2413
Exon (1)1..478
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (2)479..563
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (3)564..641
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (4)642..763
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (5)764..871
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (6)872..1072
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (7)1073..1169
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (8)1170..1203
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (9)1204..1318
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (10)1319..1483
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (11)1484..1588
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (12)1589..1649
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (13)1650..1759
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (14)1760..1823
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (15)1824..1963
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (16)1964..2098
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (17)2099..2318
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (18)2319..2461
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (19)2462..2518
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (20)2519..2626
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (21)2627..2782
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (22)2783..2830
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Exon (23)2831..4339
Gene:NPEPPS
Gene Synonym:AAP-S; MP100; PSA
Translation MWLAAAAPSLARRLLFLGPPPPPLLLLVFSRSSRRRLHSLGLAAMPEKRPFERLPADVSP INYSLCLKPDLLDFTFEGKLEAAAQVRQATNQIVMNCADIDIITASYAPEGDEEIHATGF NYQNEDEKVTLSFPSTLQTGTGTLKIDFVGELNDKMKGFYRSKYTTPSGEVRYAAVTQFE ATDARRAFPCWDEPAIKATFDISLVVPKDRVALSNMNVIDRKPYPDDENLVEVKFARTPV MSTYLVAFVVGEYDFVETRSKDGVCVRVYTPVGKAEQGKFALEVAAKTLPFYKDYFNVPY PLPKIDLIAIADFAAGAMENWGLVTYRETALLIDPKNSCSSSRQWVALVVGHELAHQWFG NLVTMEWWTHLWLNEGFASWIEYLCVDHCFPEYDIWTQFVSADYTRAQELDALDNSHPIE VSVGHPSEVDEIFDAISYSKGASVIRMLHDYIGDKDFKKGMNMYLTKFQQKNAATEDLWE SLENASGKPIAAVMNTWTKQMGFPLIYVEAEQVEDDRLLRLSQKKFCAGGSYVGEDCPQW MVPITISTSEDPNQAKLKILMDKPEMNVVLKNVKPDQWVKLNLGTVGFYRTQYSSAMLES LLPGIRDLSLPPVDRLGLQNDLFSLARAGIISTVEVLKVMEAFVNEPNYTVWSDLSCNLG ILSTLLSHTDFYEEIQEFVKDVFSPIGERLGWDPKPGEGHLDALLRGLVLGKLGKAGHKA TLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQADMQEEKNRIE RVLGATLLPDLIQKVLTFALSEEVRPQDTVSVIGGVAGGSKHGRKAAWKFIKDNWEELYN RYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENILLNAAWLKR DAESIHQYLLQRKASPPTV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
45+dbSNP:
45+g, tdbSNP:2611985
57+a, cdbSNP:2611984
105+a, gdbSNP:2611983
149+g, tdbSNP:142358928
341+c, tdbSNP:200065879
442+c, tdbSNP:201212390
646+dbSNP:
646+a, gdbSNP:202147565
950+dbSNP:
950+a, gdbSNP:149179597
1022+c, tdbSNP:3968300
1051+a, gdbSNP:4060752
1066+a, gdbSNP:3968301
1294+dbSNP:
1294+a, gdbSNP:145829042
1521+dbSNP:
1521+g, tdbSNP:200616431
1616+dbSNP:
1616+c, tdbSNP:148379754
1691+dbSNP:
1691+a, gdbSNP:200634700
1711+c, tdbSNP:201718491
1726+c, gdbSNP:190795420
1743+a, gdbSNP:200095837
1777+dbSNP:
1777+a, gdbSNP:199627398
1778+c, tdbSNP:199810184
1789+c, gdbSNP:79778933
2040+dbSNP:
2040+a, gdbSNP:201311692
2055+c, tdbSNP:148467949
2275+dbSNP:
2275+a, tdbSNP:200255738
2280+c, tdbSNP:200402839
2326+dbSNP:
2326+c, tdbSNP:201093766
2653+dbSNP:
2653+a, gdbSNP:187845212
2840+dbSNP:
2840+c, gdbSNP:34598464
2958+a, gdbSNP:201842079
3007..3008+, gggcdbSNP:149267740
3044+c, tdbSNP:111492806
3309..3310+, gdbSNP:34314592
3443+a, tdbSNP:149109100
3476+a, gdbSNP:1801416
3489+, tdbSNP:57585141
3524+a, cdbSNP:190680892
3704+c, tdbSNP:181526426
3835+c, tdbSNP:17609248
3926+c, tdbSNP:17677508
3970+c, tdbSNP:143209825
4034..4035+, aadbSNP:201093336
4081..4082+, ctadbSNP:80256006
4082..4083+, ctadbSNP:71712895
4084..4085+, ctadbSNP:3065062
4085+a, cdbSNP:80040289
4105+c, gdbSNP:3809866
4146..4149+, cctadbSNP:148390023
4152+, tdbSNP:199946088
4160+a, gdbSNP:3087904
Gene SymbolNPEPPS
Gene SynonymAAP-S; MP100; PSA
Chromosome17
Locus Map17q21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006310 Homo sapiens aminopeptidase puromycin sensitive (NPEPPS), mRNA. On-demand $899.00 20
Title Puromycin-sensitive aminopeptidase (PSA/NPEPPS) impedes development of neuropathology in hPSA/TAU(P301L) double-transgenic mice .
Author Kudo,L.C., Parfenova,L., Ren,G., Vi,N., Hui,M., Ma,Z., Lau,K., Gray,M., Bardag-Gorce,F., Wiedau-Pazos,M., Hui,K.S. and Karsten,S.L.
Journal Hum. Mol. Genet. 20 (9), 1820-1833 (2011)
Title Puromycin-sensitive aminopeptidase protects against aggregation-prone proteins via autophagy .
Author Menzies,F.M., Hourez,R., Imarisio,S., Raspe,M., Sadiq,O., Chandraratna,D., O'Kane,C., Rock,K.L., Reits,E., Goldberg,A.L. and Rubinsztein,D.C.
Journal Hum. Mol. Genet. 19 (23), 4573-4586 (2010)
Title Involvement of puromycin-sensitive aminopeptidase in proteolysis of tau protein in cultured cells, and attenuated proteolysis of frontotemporal dementia and parkinsonism linked to chromosome 17 (FTDP-17) mutant tau .
Author Yanagi,K., Tanaka,T., Kato,K., Sadik,G., Morihara,T., Kudo,T. and Takeda,M.
Journal Psychogeriatrics 9 (4), 157-166 (2009)
Title Cobalt chloride-induced downregulation of puromycin-sensitive aminopeptidase suppresses the migration and invasion of PC-3 cells .
Author Lee,S.H. and Kim,H.G.
Journal J. Microbiol. Biotechnol. 19 (5), 530-536 (2009)
Title Analysis of conserved residues of the human puromycin-sensitive aminopeptidase .
Author Thompson,M.W. and Hersh,L.B.
Journal Peptides 24 (9), 1359-1365 (2003)
Title cDNA cloning and molecular characterization of human brain metalloprotease MP100: a beta-secretase candidate? .
Author Huber,G., Thompson,A., Gruninger,F., Mechler,H., Hochstrasser,R., Hauri,H.P. and Malherbe,P.
Journal J. Neurochem. 72 (3), 1215-1223 (1999)
Title Cloning of the human puromycin-sensitive aminopeptidase and evidence for expression in neurons .
Author Tobler,A.R., Constam,D.B., Schmitt-Graff,A., Malipiero,U., Schlapbach,R. and Fontana,A.
Journal J. Neurochem. 68 (3), 889-897 (1997)
Title Puromycin-sensitive aminopeptidase. Sequence analysis, expression, and functional characterization .
Author Constam,D.B., Tobler,A.R., Rensing-Ehl,A., Kemler,I., Hersh,L.B. and Fontana,A.
Journal J. Biol. Chem. 270 (45), 26931-26939 (1995)
Title Immunocytochemical comparison of cultured normal epithelial prostatic cells with prostatic tissue sections .
Author Cussenot,O., Berthon,P., Cochand-Priollet,B., Maitland,N.J. and Le Duc,A.
Journal Exp. Cell Res. 214 (1), 83-92 (1994)
Title Studies on the tissue distribution of the puromycin-sensitive enkephalin-degrading aminopeptidases .
Author McLellan,S., Dyer,S.H., Rodriguez,G. and Hersh,L.B.
Journal J. Neurochem. 51 (5), 1552-1559 (1988)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.