Homo sapiens C-type lectin domain family 10, member A (CLEC10A), transcript variant 2, mRNA.
| RefSeq Version | NM_006344.2, 53832015 |
| Length | 1716 bp |
| Structure | linear |
| Update Date | 11-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens C-type lectin domain family 10, member A (CLEC10A), transcript variant 2, mRNA. |
| Product | C-type lectin domain family 10 member A isoform 2 |
| Comment | Summary: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell surface antigen. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]. Transcript Variant: This variant (2) lacks an in-frame segment of the coding region, compared to variant 1. It encodes a shorter isoform (2), compared to isoform 1. COMPLETENESS: complete on the 3' end. |
| RefSeq | NP_006335.2 |
| CDS | 304..1182 | Exon (1) | 1..230 | Exon (2) | 1..230 | Exon (3) | 231..370 | Exon (4) | 371..487 | Exon (5) | 488..583 | Exon (6) | 584..655 | Exon (7) | 656..751 | Exon (8) | 752..906 | Exon (9) | 907..1013 | Exon (10) | 1014..1699 |
| Translation | MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGF
QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAVHS
EMLLRVQQLVQDLKKLTCQVATLNNNGEEASTEGTCCPVNWVEHQDSCYWFSHSGMSWAE
AEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWK
PGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(72) | - | c, a | dbSNP:11653290 |
| complement(96) | - | g, a | dbSNP:73242048 |
| complement(134) | - | g, a | dbSNP:55835902 |
| complement(248) | - | g, a | dbSNP:117329388 |
| complement(400) | - | g, a | dbSNP:78714016 |
| complement(406) | - | g, a | dbSNP:90951 |
| complement(450) | - | g, c | dbSNP:732828 |
| complement(521) | - | t, c | dbSNP:16956478 |
| 602 | + | c, t | dbSNP:35318160 |
| 646 | + | c, t | dbSNP:36097216 |
| complement(715) | - | g, a | dbSNP:112729653 |
| complement(777) | - | g, a | dbSNP:364569 |
| 839 | + | c, g | dbSNP:35101468 |
| complement(840) | - | g, a | dbSNP:79945463 |
| complement(927) | - | t, c | dbSNP:17853871 |
| complement(1038) | - | g, a | dbSNP:112204401 |
| complement(1054) | - | t, c | dbSNP:115347328 |
| complement(1065) | - | t, c | dbSNP:77660925 |
| complement(1235) | - | g, a | dbSNP:78425351 |
| 1236 | + | c, t | dbSNP:15623 |
| complement(1252) | - | t, c | dbSNP:113846982 |
| 1377 | + | g, t | dbSNP:3785796 |
| 1485 | + | c, t | dbSNP:3785797 |
| 1490 | + | a, g | dbSNP:3785798 |
| 1549 | + | c, g | dbSNP:1698225 |
| complement(1634) | - | t, g | dbSNP:116428693 |
| Gene Symbol | CLEC10A |
| Gene Synonym | CD301; CLECSF13; CLECSF14; HML; HML2; MGL |
| Chromosome | 17 |
| Locus Map | 17p13.1 |
| All Transcripts | NM_006344 , NM_182906 |
| Title | New genetic associations detected in a host response study to hepatitis B vaccine . |
| Author | Davila,S., Froeling,F.E., Tan,A., Bonnard,C., Boland,G.J., Snippe,H., Hibberd,M.L. and Seielstad,M. |
| Journal | Genes Immun. 11 (3), 232-238 (2010) |
| Title | Single nucleotide polymorphism of TAG-1 influences IVIg responsiveness of Japanese patients with CIDP . |
| Author | Iijima,M., Tomita,M., Morozumi,S., Kawagashira,Y., Nakamura,T., Koike,H., Katsuno,M., Hattori,N., Tanaka,F., Yamamoto,M. and Sobue,G. |
| Journal | Neurology 73 (17), 1348-1352 (2009) |
| Title | Variation of Neisseria gonorrhoeae lipooligosaccharide directs dendritic cell-induced T helper responses . |
| Author | van Vliet,S.J., Steeghs,L., Bruijns,S.C., Vaezirad,M.M., Snijders Blok,C., Arenas Busto,J.A., Deken,M., van Putten,J.P. and van Kooyk,Y. |
| Journal | PLoS Pathog. 5 (10), E1000625 (2009) |
| Title | Molecular cloning and expression of cDNA encoding human macrophage C-type lectin. Its unique carbohydrate binding specificity for Tn antigen . |
| Author | Suzuki,N., Yamamoto,K., Toyoshima,S., Osawa,T. and Irimura,T. |
| Journal | J. Immunol. 156 (1), 128-135 (1996) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |