• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens C-type lectin domain family 10, member A (CLEC10A), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_006344 Homo sapiens C-type lectin domain family 10, member A (CLEC10A), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $449.00 14

*Business Day

Related Services

RefSeq Version NM_006344.2, 53832015
Length 1716 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens C-type lectin domain family 10, member A (CLEC10A), transcript variant 2, mRNA.
Product C-type lectin domain family 10 member A isoform 2
Comment

Summary: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell surface antigen. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (2) lacks an in-frame segment of the coding region, compared to variant 1. It encodes a shorter isoform (2), compared to isoform 1.


##Evidence-Data-START## Transcript exon combination :: D50532.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025098 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_006335.2
CDS 304..1182
Misc Feature(1)274..276
Misc Feature(2)319..732
Misc Feature(3)319..732
Misc Feature(4)772..1146
Misc Feature(5)order(937..939,1030..1032,1036..1038,1069..1071,
Misc Feature(6)order(958..960,964..966,1039..1041,1069..1074)
Misc Feature(7)order(964..966,1072..1074)
Exon (1)1..230
Gene:CLEC10A
Gene Synonym:CD301; CLECSF13; CLECSF14; HML; HML2; MGL
Exon (2)231..370
Gene:CLEC10A
Gene Synonym:CD301; CLECSF13; CLECSF14; HML; HML2; MGL
Exon (3)371..487
Gene:CLEC10A
Gene Synonym:CD301; CLECSF13; CLECSF14; HML; HML2; MGL
Exon (4)488..583
Gene:CLEC10A
Gene Synonym:CD301; CLECSF13; CLECSF14; HML; HML2; MGL
Exon (5)584..655
Gene:CLEC10A
Gene Synonym:CD301; CLECSF13; CLECSF14; HML; HML2; MGL
Exon (6)656..751
Gene:CLEC10A
Gene Synonym:CD301; CLECSF13; CLECSF14; HML; HML2; MGL
Exon (7)752..906
Gene:CLEC10A
Gene Synonym:CD301; CLECSF13; CLECSF14; HML; HML2; MGL
Exon (8)907..1013
Gene:CLEC10A
Gene Synonym:CD301; CLECSF13; CLECSF14; HML; HML2; MGL
Exon (9)1014..1699
Gene:CLEC10A
Gene Synonym:CD301; CLECSF13; CLECSF14; HML; HML2; MGL
Translation MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGF QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAVHS EMLLRVQQLVQDLKKLTCQVATLNNNGEEASTEGTCCPVNWVEHQDSCYWFSHSGMSWAE AEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWK PGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(72)-dbSNP:
complement(72)-c, adbSNP:11653290
complement(96)-g, adbSNP:73242048
complement(103)-g, cdbSNP:181142956
complement(107)-t, gdbSNP:189052490
complement(134)-g, adbSNP:55835902
complement(145)-g, adbSNP:184242724
complement(149)-t, cdbSNP:193271222
complement(168)-t, cdbSNP:148814818
complement(199)-g, adbSNP:190232137
complement(248)-dbSNP:
complement(248)-g, adbSNP:117329388
complement(310)-t, cdbSNP:142535416
complement(385)-dbSNP:
complement(385)-g, adbSNP:199974072
complement(400)-g, adbSNP:78714016
complement(401)-t, cdbSNP:200835319
complement(406)-g, adbSNP:90951
complement(438)-t, cdbSNP:182767360
complement(450)-g, cdbSNP:732828
complement(468)-g, adbSNP:139902883
complement(472)-t, cdbSNP:147504959
complement(504)-dbSNP:
complement(504)-t, gdbSNP:1129831
complement(521)-t, cdbSNP:16956478
complement(536)-t, gdbSNP:200378911
complement(556)-t, cdbSNP:199755396
complement(558)-t, cdbSNP:140873453
complement(564)-g, cdbSNP:139216491
complement(569)-g, adbSNP:150615003
complement(602)-dbSNP:
complement(602)-t, cdbSNP:35318160
complement(646)-t, cdbSNP:36097216
complement(683)-dbSNP:
complement(683)-t, cdbSNP:201647706
complement(715)-g, adbSNP:112729653
complement(730)-t, gdbSNP:147471445
complement(753)-dbSNP:
complement(753)-g, cdbSNP:143134980
complement(765)-g, cdbSNP:199833742
complement(767)-g, cdbSNP:200740525
complement(777)-g, adbSNP:364569
complement(787)-t, cdbSNP:146827384
complement(839)-g, cdbSNP:35101468
complement(840)-g, adbSNP:79945463
complement(887)-t, adbSNP:138348118
complement(925)-dbSNP:
complement(925)-g, adbSNP:150484759
complement(927)-t, cdbSNP:17853871
complement(999)-g, adbSNP:140041915
complement(1038)-dbSNP:
complement(1038)-g, adbSNP:112204401
complement(1039)-t, cdbSNP:200496384
complement(1040)-t, cdbSNP:140942315
complement(1051)-g, adbSNP:146480775
complement(1053)-g, adbSNP:142642957
complement(1054)-t, cdbSNP:115347328
complement(1069)-t, cdbSNP:145596692
complement(1097)-c, adbSNP:149746467
complement(1113)-g, adbSNP:139844327
complement(1114)-t, cdbSNP:200373971
complement(1143)-g, adbSNP:147465833
complement(1199)-g, adbSNP:201054202
complement(1222)-c, adbSNP:146844702
complement(1235)-g, adbSNP:78425351
complement(1236)-t, cdbSNP:15623
complement(1251)-g, adbSNP:188363668
complement(1252)-t, cdbSNP:113846982
complement(1259)-g, adbSNP:191811013
complement(1260)-t, cdbSNP:138660752
complement(1377)-t, gdbSNP:3785796
complement(1485)-t, cdbSNP:3785797
complement(1490)-g, adbSNP:3785798
complement(1549)-g, cdbSNP:1698225
complement(1634)-t, gdbSNP:116428693
complement(1653)-g, adbSNP:149105806
Gene SymbolCLEC10A
Gene SynonymCD301; CLECSF13; CLECSF14; HML; HML2; MGL
Chromosome17
Locus Map17p13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006344 Homo sapiens C-type lectin domain family 10, member A (CLEC10A), transcript variant 2, mRNA. On-demand $449.00 14
NM_182906 Homo sapiens C-type lectin domain family 10, member A (CLEC10A), transcript variant 1, mRNA. In-stock $418.00 $369.00 10
Title Protein domain histochemistry (PDH): binding of the carbohydrate recognition domain (CRD) of recombinant human glycoreceptor CLEC10A (CD301) to formalin-fixed, paraffin-embedded breast cancer tissues .
Author Nollau,P., Wolters-Eisfeld,G., Mortezai,N., Kurze,A.K., Klampe,B., Debus,A., Bockhorn,M., Niendorf,A. and Wagener,C.
Journal J. Histochem. Cytochem. 61 (3), 199-205 (2013)
Title Targeting of macrophage galactose-type C-type lectin (MGL) induces .
Author Napoletano,C., Zizzari,I.G., Rughetti,A., Rahimi,H., Irimura,T., Clausen,H., Wandall,H.H., Belleudi,F., Bellati,F., Pierelli,L., Frati,L. and Nuti,M.
Journal Eur. J. Immunol. 42 (4), 936-945 (2012)
Title New genetic associations detected in a host response study to hepatitis B vaccine .
Author Davila,S., Froeling,F.E., Tan,A., Bonnard,C., Boland,G.J., Snippe,H., Hibberd,M.L. and Seielstad,M.
Journal Genes Immun. 11 (3), 232-238 (2010)
Title Single nucleotide polymorphism of TAG-1 influences IVIg responsiveness of Japanese patients with CIDP .
Author Iijima,M., Tomita,M., Morozumi,S., Kawagashira,Y., Nakamura,T., Koike,H., Katsuno,M., Hattori,N., Tanaka,F., Yamamoto,M. and Sobue,G.
Journal Neurology 73 (17), 1348-1352 (2009)
Title Variation of Neisseria gonorrhoeae lipooligosaccharide directs dendritic cell-induced T helper responses .
Author van Vliet,S.J., Steeghs,L., Bruijns,S.C., Vaezirad,M.M., Snijders Blok,C., Arenas Busto,J.A., Deken,M., van Putten,J.P. and van Kooyk,Y.
Journal PLoS Pathog. 5 (10), E1000625 (2009)
Title Molecular cloning and expression of cDNA encoding human macrophage C-type lectin. Its unique carbohydrate binding specificity for Tn antigen .
Author Suzuki,N., Yamamoto,K., Toyoshima,S., Osawa,T. and Irimura,T.
Journal J. Immunol. 156 (1), 128-135 (1996)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.