• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens C-type lectin domain family 10, member A (CLEC10A), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu49668 Homo sapiens C-type lectin domain family 10, member A (CLEC10A), transcript variant 2, mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu49668C Homo sapiens C-type lectin domain family 10, member A (CLEC10A), transcript variant 2, mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_006344.2, 53832015
Length 879 bp
Structure linear
Update Date 22-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens C-type lectin domain family 10, member A (CLEC10A), transcript variant 2, mRNA.
Product C-type lectin domain family 10 member A isoform 2
Comment

Summary: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell surface antigen. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (2) lacks an in-frame segment of the coding region, compared to variant 1. It encodes a shorter isoform (2), compared to isoform 1.


##Evidence-Data-START## Transcript exon combination :: D50532.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_006335.2
CDS 304..1182
Misc Feature(1)274..276
Misc Feature(2)319..732
Misc Feature(3)319..732
Misc Feature(4)772..1146
Misc Feature(5)order(937..939,1030..1032,1036..1038,1069..1071,
Misc Feature(6)order(958..960,964..966,1039..1041,1069..1074)
Misc Feature(7)order(964..966,1072..1074)
Exon (1)1..230
Gene:CLEC10A
Gene Synonym:CD301; CLECSF13; CLECSF14; HML; HML2; MGL
Exon (2)231..370
Gene:CLEC10A
Gene Synonym:CD301; CLECSF13; CLECSF14; HML; HML2; MGL
Exon (3)371..487
Gene:CLEC10A
Gene Synonym:CD301; CLECSF13; CLECSF14; HML; HML2; MGL
Exon (4)488..583
Gene:CLEC10A
Gene Synonym:CD301; CLECSF13; CLECSF14; HML; HML2; MGL
Exon (5)584..655
Gene:CLEC10A
Gene Synonym:CD301; CLECSF13; CLECSF14; HML; HML2; MGL
Exon (6)656..751
Gene:CLEC10A
Gene Synonym:CD301; CLECSF13; CLECSF14; HML; HML2; MGL
Exon (7)752..906
Gene:CLEC10A
Gene Synonym:CD301; CLECSF13; CLECSF14; HML; HML2; MGL
Exon (8)907..1013
Gene:CLEC10A
Gene Synonym:CD301; CLECSF13; CLECSF14; HML; HML2; MGL
Exon (9)1014..1699
Gene:CLEC10A
Gene Synonym:CD301; CLECSF13; CLECSF14; HML; HML2; MGL
Translation MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGF QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAVHS EMLLRVQQLVQDLKKLTCQVATLNNNGEEASTEGTCCPVNWVEHQDSCYWFSHSGMSWAE AEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWK PGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(72)-dbSNP:
complement(72)-c, adbSNP:11653290
complement(96)-g, adbSNP:73242048
complement(103)-g, cdbSNP:181142956
complement(107)-t, gdbSNP:189052490
complement(134)-g, adbSNP:55835902
complement(145)-g, adbSNP:184242724
complement(149)-t, cdbSNP:193271222
complement(168)-t, cdbSNP:148814818
complement(199)-g, adbSNP:190232137
complement(200)-t, cdbSNP:369102083
complement(247)-dbSNP:
complement(247)-g, cdbSNP:370204054
complement(248)-g, adbSNP:117329388
complement(251)-g, adbSNP:375983103
complement(290)-g, cdbSNP:374648451
complement(310)-t, cdbSNP:142535416
complement(314)-g, adbSNP:368746225
complement(315)-t, cdbSNP:371420706
complement(322)-t, cdbSNP:376911913
complement(330)-g, cdbSNP:373168046
complement(385)-dbSNP:
complement(385)-g, adbSNP:199974072
complement(400)-g, adbSNP:78714016
complement(401)-t, cdbSNP:200835319
complement(406)-g, adbSNP:90951
complement(438)-t, cdbSNP:182767360
complement(450)-g, cdbSNP:732828
complement(468)-g, adbSNP:139902883
complement(472)-t, cdbSNP:147504959
504+dbSNP:
504+g, tdbSNP:1129831
complement(521)-t, cdbSNP:16956478
complement(521)-t, cdbSNP:386541500
complement(536)-t, gdbSNP:200378911
complement(556)-t, cdbSNP:199755396
complement(558)-t, cdbSNP:140873453
complement(569)-g, adbSNP:150615003
complement(587)-dbSNP:
complement(587)-t, cdbSNP:375609717
complement(598)-t, cdbSNP:267605033
complement(602)-t, cdbSNP:35318160
complement(646)-t, cdbSNP:36097216
complement(647)-t, cdbSNP:372897858
complement(683)-dbSNP:
complement(683)-t, cdbSNP:201647706
complement(715)-g, adbSNP:112729653
complement(716)-c, adbSNP:371194421
complement(730)-t, gdbSNP:147471445
complement(753)-dbSNP:
complement(753)-g, cdbSNP:143134980
complement(765)-g, cdbSNP:199833742
complement(767)-g, cdbSNP:200740525
complement(777)-t, cdbSNP:386584575
complement(777)-g, adbSNP:364569
complement(787)-t, cdbSNP:146827384
complement(839)-g, cdbSNP:35101468
complement(840)-g, adbSNP:79945463
complement(841)-t, cdbSNP:377384027
complement(887)-t, adbSNP:138348118
complement(901)-c, adbSNP:372609073
complement(925)-dbSNP:
complement(925)-g, adbSNP:150484759
complement(927)-t, cdbSNP:17853871
complement(999)-g, adbSNP:140041915
complement(1038)-dbSNP:
complement(1038)-g, adbSNP:112204401
complement(1039)-t, cdbSNP:200496384
complement(1040)-t, cdbSNP:140942315
complement(1051)-g, adbSNP:146480775
complement(1053)-g, adbSNP:142642957
complement(1054)-t, cdbSNP:115347328
complement(1054)-g, adbSNP:386435828
complement(1069)-t, cdbSNP:145596692
complement(1072)-t, cdbSNP:375550026
complement(1095)-g, adbSNP:372729049
complement(1097)-c, adbSNP:149746467
complement(1113)-g, adbSNP:139844327
complement(1114)-t, cdbSNP:200373971
complement(1143)-g, adbSNP:147465833
complement(1144)-t, cdbSNP:371228002
complement(1150)-t, cdbSNP:376666860
complement(1199)-g, adbSNP:201054202
complement(1204)-g, adbSNP:375775825
complement(1208)-g, adbSNP:371803977
complement(1220)-t, cdbSNP:367569967
complement(1222)-c, adbSNP:146844702
complement(1235..1236)-ag, gadbSNP:386794994
complement(1235)-g, adbSNP:78425351
1236+c, tdbSNP:15623
complement(1251)-g, adbSNP:188363668
complement(1252)-t, cdbSNP:113846982
complement(1259)-g, adbSNP:191811013
complement(1260)-t, cdbSNP:138660752
complement(1377)-t, gdbSNP:3785796
complement(1429)-g, adbSNP:369196064
1485+c, tdbSNP:3785797
1490+a, gdbSNP:3785798
1549+c, gdbSNP:1698225
complement(1634)-t, gdbSNP:116428693
complement(1653)-g, adbSNP:149105806
Gene SymbolCLEC10A
Gene SynonymCD301; CLECSF13; CLECSF14; HML; HML2; MGL
Chromosome17
Locus Map17p13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006344 Homo sapiens C-type lectin domain family 10, member A (CLEC10A), transcript variant 2, mRNA. On-demand $159.00 7-9
NM_182906 Homo sapiens C-type lectin domain family 10, member A (CLEC10A), transcript variant 1, mRNA. In-stock $99.00 5-7
XM_005256411 PREDICTED: Homo sapiens C-type lectin domain family 10, member A (CLEC10A), transcript variant X1, mRNA. On-demand $159.00 7-9
XM_005256412 PREDICTED: Homo sapiens C-type lectin domain family 10, member A (CLEC10A), transcript variant X2, mRNA. On-demand $159.00 7-9
Title Human T cell activation results in extracellular signal-regulated kinase (ERK)-calcineurin-dependent exposure of Tn antigen on the cell surface and binding of the macrophage galactose-type lectin (MGL) .
Author van Vliet SJ, Vuist IM, Lenos K, Tefsen B, Kalay H, Garcia-Vallejo
Journal J. Biol. Chem. 288 (38), 27519-27532 (2013)
Title MGL signaling augments TLR2-mediated responses for enhanced IL-10 and TNF-alpha secretion .
Author van Vliet SJ, Bay S, Vuist IM, Kalay H, Garcia-Vallejo JJ, Leclerc
Journal J. Leukoc. Biol. 94 (2), 315-323 (2013)
Title Protein domain histochemistry (PDH): binding of the carbohydrate recognition domain (CRD) of recombinant human glycoreceptor CLEC10A (CD301) to formalin-fixed, paraffin-embedded breast cancer tissues .
Author Nollau P, Wolters-Eisfeld G, Mortezai N, Kurze AK, Klampe B, Debus A, Bockhorn M, Niendorf A and Wagener C.
Journal J. Histochem. Cytochem. 61 (3), 199-205 (2013)
Title Targeting of macrophage galactose-type C-type lectin (MGL) induces .
Author Napoletano C, Zizzari IG, Rughetti A, Rahimi H, Irimura T, Clausen H, Wandall HH, Belleudi F, Bellati F, Pierelli L, Frati L and Nuti M.
Journal Eur. J. Immunol. 42 (4), 936-945 (2012)
Title New genetic associations detected in a host response study to hepatitis B vaccine .
Author Davila S, Froeling FE, Tan A, Bonnard C, Boland GJ, Snippe H, Hibberd ML and Seielstad M.
Journal Genes Immun. 11 (3), 232-238 (2010)
Title Single nucleotide polymorphism of TAG-1 influences IVIg responsiveness of Japanese patients with CIDP .
Author Iijima M, Tomita M, Morozumi S, Kawagashira Y, Nakamura T, Koike H, Katsuno M, Hattori N, Tanaka F, Yamamoto M and Sobue G.
Journal Neurology 73 (17), 1348-1352 (2009)
Title Variation of Neisseria gonorrhoeae lipooligosaccharide directs dendritic cell-induced T helper responses .
Author van Vliet SJ, Steeghs L, Bruijns SC, Vaezirad MM, Snijders Blok C, Arenas Busto JA, Deken M, van Putten JP and van Kooyk Y.
Journal PLoS Pathog. 5 (10), E1000625 (2009)
Title Molecular cloning and expression of cDNA encoding human macrophage C-type lectin. Its unique carbohydrate binding specificity for Tn antigen .
Author Suzuki N, Yamamoto K, Toyoshima S, Osawa T and Irimura T.
Journal J. Immunol. 156 (1), 128-135 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.