Homo sapiens homeobox B13 (HOXB13), mRNA.
| RefSeq Version | NM_006361.5, 84043952 |
| Length | 3047 bp |
| Structure | linear |
| Update Date | 13-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens homeobox B13 (HOXB13), mRNA. |
| Product | homeobox protein Hox-B13 |
| Comment | Summary: This gene encodes a transcription factor that belongs to the homeobox gene family. Genes of this family are highly conserved among vertebrates and essential for vertebrate embryonic development. This gene has been implicated to play a role in fetal skin development and cutaneous regeneration. In mice, a similar gene was shown to exhibit temporal and spatial colinearity in the main body axis of the embryo, but was not expressed in the secondary axes, which suggests functions in body patterning along the axis. This gene and other HOXB genes form a gene cluster at chromosome the 17q21-22 region. [provided by RefSeq]. |
| RefSeq | NP_006352.2 |
| CDS | 157..1011 | Exon (1) | 1..757 | Exon (2) | 1..757 | Exon (3) | 758..3038 |
| Translation | MEPGNYATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPP
KQCHPCPGVPQGTSPAPVPYGYFGGGYYSCRVSRSSLKPCAQAATLAAYPAETPTAGEEY
PSRPTEFAFYPGYPGTYQPMASYLDVSVVQTLGAPGEPRHDSLLPVDSYQSWALAGGWNS
QMCCQGEQNPPGPFWKAAFADSSGQHPPDACAFRRGRKKRIPYSKGQLRELEREYAANKF
ITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVKNSATP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(116) | - | t, c | dbSNP:61748976 |
| complement(253) | - | t, g | dbSNP:79344505 |
| 301 | + | c, g | dbSNP:11551892 |
| 486 | + | a, c | dbSNP:33993186 |
| 522 | + | c, t | dbSNP:8556 |
| complement(621) | - | c, a | dbSNP:75508871 |
| 630 | + | a, g | dbSNP:35033273 |
| complement(669) | - | g, a | dbSNP:9900627 |
| complement(1008) | - | , a | dbSNP:77179853 |
| 1312 | + | a, g | dbSNP:2280353 |
| 1330 | + | a, g | dbSNP:2280354 |
| complement(1454) | - | g, c | dbSNP:79982443 |
| complement(1512) | - | c, a | dbSNP:77879770 |
| complement(1514) | - | t, c | dbSNP:77826411 |
| complement(1625) | - | t, c | dbSNP:11653611 |
| complement(1873) | - | g, a | dbSNP:113568340 |
| complement(1927) | - | g, a | dbSNP:79214867 |
| 2168 | + | a, c | dbSNP:1056656 |
| complement(2494) | - | t, c | dbSNP:8069269 |
| complement(2533) | - | t, c | dbSNP:8069252 |
| complement(2583) | - | g, a | dbSNP:8065051 |
| complement(2602) | - | g, a | dbSNP:3107299 |
| complement(2624) | - | g, c | dbSNP:8081840 |
| complement(2628) | - | g, a | dbSNP:8065028 |
| complement(2804) | - | t, c | dbSNP:61123825 |
| complement(2834) | - | t, c | dbSNP:79812861 |
| complement(2847) | - | t, g | dbSNP:8068732 |
| complement(2849) | - | t, g | dbSNP:116931900 |
| complement(2879) | - | c, a | dbSNP:8082520 |
| complement(2934) | - | t, c | dbSNP:8068566 |
| complement(2984) | - | c, a | dbSNP:8064432 |
| Title | A FOXA1-binding enhancer regulates Hoxb13 expression in the prostate gland . |
| Author | McMullin,R.P., Dobi,A., Mutton,L.N., Orosz,A., Maheshwari,S., Shashikant,C.S. and Bieberich,C.J. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 107 (1), 98-103 (2010) |
| Title | Predictive relevance of HOXB13 protein expression for tamoxifen benefit in breast cancer . |
| Author | Jerevall,P.L., Jansson,A., Fornander,T., Skoog,L., Nordenskjold,B. and Stal,O. |
| Journal | Breast Cancer Res. 12 (4), R53 (2010) |
| Title | HOXB13 promotes androgen independent growth of LNCaP prostate cancer cells by the activation of E2F signaling . |
| Author | Kim,Y.R., Oh,K.J., Park,R.Y., Xuan,N.T., Kang,T.W., Kwon,D.D., Choi,C., Kim,M.S., Nam,K.I., Ahn,K.Y. and Jung,C. |
| Journal | Mol. Cancer 9, 124 (2010) |
| Title | The homeodomain protein HOXB13 regulates the cellular response to androgens . |
| Author | Norris,J.D., Chang,C.Y., Wittmann,B.M., Kunder,R.S., Cui,H., Fan,D., Joseph,J.D. and McDonnell,D.P. |
| Journal | Mol. Cell 36 (3), 405-416 (2009) |
| Title | Cytochrome P450 2D6 and homeobox 13/interleukin-17B receptor: combining inherited and tumor gene markers for prediction of tamoxifen resistance . |
| Author | Goetz,M.P., Suman,V.J., Couch,F.J., Ames,M.M., Rae,J.M., Erlander,M.G., Ma,X.J., Sgroi,D.C., Reynolds,C.A., Lingle,W.L., Weinshilboum,R.M., Flockhart,D.A., Desta,Z., Perez,E.A. and Ingle,J.N. |
| Journal | Clin. Cancer Res. 14 (18), 5864-5868 (2008) |
| Title | HOXB13 homeodomain protein is cytoplasmic throughout fetal skin development . |
| Author | Komuves,L.G., Ma,X.K., Stelnicki,E., Rozenfeld,S., Oda,Y. and Largman,C. |
| Journal | Dev. Dyn. 227 (2), 192-202 (2003) |
| Title | Complete mutation analysis panel of the 39 human HOX genes . |
| Author | Kosaki,K., Kosaki,R., Suzuki,T., Yoshihashi,H., Takahashi,T., Sasaki,K., Tomita,M., McGinnis,W. and Matsuo,N. |
| Journal | Teratology 65 (2), 50-62 (2002) |
| Title | Modulation of the human homeobox genes PRX-2 and HOXB13 in scarless fetal wounds . |
| Author | Stelnicki,E.J., Arbeit,J., Cass,D.L., Saner,C., Harrison,M. and Largman,C. |
| Journal | J. Invest. Dermatol. 111 (1), 57-63 (1998) |
| Title | AbdB-like Hox proteins stabilize DNA binding by the Meis1 homeodomain proteins . |
| Author | Shen,W.F., Montgomery,J.C., Rozenfeld,S., Moskow,J.J., Lawrence,H.J., Buchberg,A.M. and Largman,C. |
| Journal | Mol. Cell. Biol. 17 (11), 6448-6458 (1997) |
| Title | Hoxb-13: a new Hox gene in a distant region of the HOXB cluster maintains colinearity . |
| Author | Zeltser,L., Desplan,C. and Heintz,N. |
| Journal | Development 122 (8), 2475-2484 (1996) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |