• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens homeobox B13 (HOXB13), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_006361 Homo sapiens homeobox B13 (HOXB13), mRNA. GenEZ ORF Cloning In-stock $348.00 $299.00 10

*Business Day

Related Services

RefSeq Version NM_006361.5, 84043952
Length 3047 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens homeobox B13 (HOXB13), mRNA.
Product homeobox protein Hox-B13
Comment

Summary: This gene encodes a transcription factor that belongs to the homeobox gene family. Genes of this family are highly conserved among vertebrates and essential for vertebrate embryonic development. This gene has been implicated to play a role in fetal skin development and cutaneous regeneration. In mice, a similar gene was shown to exhibit temporal and spatial colinearity in the main body axis of the embryo, but was not expressed in the secondary axes, which suggests functions in body patterning along the axis. This gene and other HOXB genes form a gene cluster at chromosome the 17q21-22 region. [provided by RefSeq, Jul 2008].

RefSeq NP_006352.2
CDS 157..1011
Misc Feature(1)184..525
Misc Feature(2)184..525
Misc Feature(3)805..975
Misc Feature(4)order(805..819,823..825,874..876,892..894,931..933,
Misc Feature(5)order(811..813,820..822,940..942,949..954,961..963)
Exon (1)1..757
Gene:HOXB13
Gene Synonym:PSGD
Exon (2)758..3038
Gene:HOXB13
Gene Synonym:PSGD
Translation MEPGNYATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPP KQCHPCPGVPQGTSPAPVPYGYFGGGYYSCRVSRSSLKPCAQAATLAAYPAETPTAGEEY PSRPTEFAFYPGYPGTYQPMASYLDVSVVQTLGAPGEPRHDSLLPVDSYQSWALAGGWNS QMCCQGEQNPPGPFWKAAFADSSGQHPPDACAFRRGRKKRIPYSKGQLRELEREYAANKF ITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVKNSATP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(8)-dbSNP:
complement(8)-g, adbSNP:147157748
complement(65)-t, gdbSNP:375682349
complement(66)-t, cdbSNP:373833700
complement(81)-t, cdbSNP:200066609
complement(110)-g, adbSNP:200891371
complement(116)-t, c, adbSNP:61748976
complement(151)-t, cdbSNP:375857762
complement(162)-t, cdbSNP:371544984
complement(219)-t, cdbSNP:368505949
complement(253)-t, gdbSNP:79344505
complement(278)-g, adbSNP:199799743
301+c, gdbSNP:11551892
complement(344)-t, cdbSNP:199813155
complement(364)-g, adbSNP:370934116
complement(407)-t, cdbSNP:138213197
complement(459)-g, cdbSNP:150413396
complement(470)-g, adbSNP:140492479
complement(484)-g, cdbSNP:370361482
complement(486)-c, adbSNP:33993186
complement(522)-t, cdbSNP:8556
complement(522)-g, adbSNP:386617571
complement(524)-t, cdbSNP:201428095
complement(567)-g, adbSNP:377339084
complement(610)-t, gdbSNP:140373548
630+a, gdbSNP:35033273
complement(645)-g, cdbSNP:199561305
complement(663)-g, adbSNP:373766741
complement(669)-g, adbSNP:9900627
complement(679)-c, adbSNP:148649390
complement(723)-g, adbSNP:143945091
complement(738)-g, adbSNP:201780092
complement(762)-dbSNP:
complement(762)-g, adbSNP:370633734
complement(790)-t, cdbSNP:145059285
complement(802)-c, adbSNP:375917549
complement(805)-g, adbSNP:139475791
complement(834)-t, cdbSNP:200362093
complement(886)-t, cdbSNP:372121677
complement(891)-t, cdbSNP:138675188
complement(929)-t, cdbSNP:367732101
complement(982)-t, cdbSNP:191886930
complement(988)-c, adbSNP:200997384
complement(1005)-g, adbSNP:374736844
complement(1008)-, adbSNP:398102310
complement(1009)-, adbSNP:77179853
complement(1039)-t, gdbSNP:371753257
complement(1065)-g, cdbSNP:144967504
complement(1068)-t, cdbSNP:141179592
complement(1082)-t, gdbSNP:187442839
complement(1126)-t, cdbSNP:183620920
complement(1224)-g, cdbSNP:192244427
1312+a, gdbSNP:2280353
1330+a, gdbSNP:2280354
complement(1330)-g, adbSNP:386563480
complement(1331)-g, adbSNP:146552906
complement(1454)-g, cdbSNP:79982443
complement(1532)-t, adbSNP:187003057
complement(1557)-t, cdbSNP:144241488
complement(1625)-t, cdbSNP:11653611
complement(1873)-g, adbSNP:113568340
complement(1902)-g, c, adbSNP:184053751
complement(1927)-g, adbSNP:79214867
2168+a, cdbSNP:1056656
complement(2175)-t, cdbSNP:371876392
complement(2190)-t, cdbSNP:189589365
complement(2246)-t, cdbSNP:368411572
complement(2344)-t, gdbSNP:374232757
complement(2382)-g, adbSNP:368424992
complement(2494)-t, cdbSNP:8069269
complement(2533)-t, cdbSNP:8069252
complement(2583)-g, adbSNP:8065051
complement(2602)-g, adbSNP:3107299
complement(2624)-g, cdbSNP:8081840
complement(2628)-g, adbSNP:8065028
complement(2630)-t, cdbSNP:142428986
2751+a, gdbSNP:148791210
complement(2804)-t, cdbSNP:61123825
complement(2834)-t, cdbSNP:79812861
complement(2844)-g, cdbSNP:145426191
complement(2847)-t, gdbSNP:8068732
complement(2849)-t, gdbSNP:116931900
complement(2879)-c, adbSNP:8082520
complement(2934)-t, cdbSNP:8068566
complement(2984)-c, adbSNP:8064432
Gene SymbolHOXB13
Gene SynonymPSGD
Chromosome17
Locus Map17q21.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006361 Homo sapiens homeobox B13 (HOXB13), mRNA. In-stock $348.00 $299.00 10
Title A prostate cancer susceptibility allele at 6q22 increases RFX6 expression by modulating HOXB13 chromatin binding .
Author Huang Q, Whitington T, Gao P, Lindberg JF, Yang Y, Sun J, Vaisanen MR, Szulkin R, Annala M, Yan J, Egevad LA, Zhang K, Lin R, Jolma A, Nykter M, Manninen A, Wiklund F, Vaarala MH, Visakorpi T, Xu J, Taipale J and Wei GH.
Journal Nat. Genet. 46 (2), 126-135 (2014)
Title G84E mutation in HOXB13 is firmly associated with prostate cancer risk: a meta-analysis .
Author Huang H and Cai B.
Journal Tumour Biol. 35 (2), 1177-1182 (2014)
Title HOXB13 is a sensitive and specific marker of prostate cells, useful in distinguishing between carcinomas of prostatic and urothelial origin .
Author Varinot J, Cussenot O, Roupret M, Conort P, Bitker MO, Chartier-Kastler E, Cheng L and Comperat E.
Journal Virchows Arch. 463 (6), 803-809 (2013)
Title HOXB13 mediates tamoxifen resistance and invasiveness in human breast cancer by suppressing ERalpha and inducing IL-6 expression .
Author Shah N, Jin K, Cruz LA, Park S, Sadik H, Cho S, Goswami CP, Nakshatri H, Gupta R, Chang HY, Zhang Z, Cimino-Mathews A, Cope L, Umbricht C and Sukumar S.
Journal Cancer Res. 73 (17), 5449-5458 (2013)
Title Prediction of late disease recurrence and extended adjuvant letrozole benefit by the HOXB13/IL17BR biomarker .
Author Sgroi DC, Carney E, Zarrella E, Steffel L, Binns SN, Finkelstein DM, Szymonifka J, Bhan AK, Shepherd LE, Zhang Y, Schnabel CA, Erlander MG, Ingle JN, Porter P, Muss HB, Pritchard KI, Tu D, Rimm
Journal J. Natl. Cancer Inst. 105 (14), 1036-1042 (2013)
Title HOXB13 homeodomain protein is cytoplasmic throughout fetal skin development .
Author Komuves LG, Ma XK, Stelnicki E, Rozenfeld S, Oda Y and Largman C.
Journal Dev. Dyn. 227 (2), 192-202 (2003)
Title Complete mutation analysis panel of the 39 human HOX genes .
Author Kosaki K, Kosaki R, Suzuki T, Yoshihashi H, Takahashi T, Sasaki K, Tomita M, McGinnis W and Matsuo N.
Journal Teratology 65 (2), 50-62 (2002)
Title Modulation of the human homeobox genes PRX-2 and HOXB13 in scarless fetal wounds .
Author Stelnicki EJ, Arbeit J, Cass DL, Saner C, Harrison M and Largman C.
Journal J. Invest. Dermatol. 111 (1), 57-63 (1998)
Title AbdB-like Hox proteins stabilize DNA binding by the Meis1 homeodomain proteins .
Author Shen WF, Montgomery JC, Rozenfeld S, Moskow JJ, Lawrence HJ, Buchberg AM and Largman C.
Journal Mol. Cell. Biol. 17 (11), 6448-6458 (1997)
Title Hoxb-13: a new Hox gene in a distant region of the HOXB cluster maintains colinearity .
Author Zeltser L, Desplan C and Heintz N.
Journal Development 122 (8), 2475-2484 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.