• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens homeobox B13 (HOXB13), mRNA.


RefSeq Accession Definition Services Price Order
NM_006361 Homo sapiens homeobox B13 (HOXB13), mRNA. ORF Sequence $247.95
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_006361.5, 84043952
Length 3047 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens homeobox B13 (HOXB13), mRNA.
Product homeobox protein Hox-B13
Comment

Summary: This gene encodes a transcription factor that belongs to the homeobox gene family. Genes of this family are highly conserved among vertebrates and essential for vertebrate embryonic development. This gene has been implicated to play a role in fetal skin development and cutaneous regeneration. In mice, a similar gene was shown to exhibit temporal and spatial colinearity in the main body axis of the embryo, but was not expressed in the secondary axes, which suggests functions in body patterning along the axis. This gene and other HOXB genes form a gene cluster at chromosome the 17q21-22 region. [provided by RefSeq, Jul 2008].

RefSeq NP_006352.2
CDS 157..1011
Misc Feature(1)184..525
Misc Feature(2)184..525
Misc Feature(3)805..975
Misc Feature(4)order(805..819,823..825,874..876,892..894,931..933,
Misc Feature(5)order(811..813,820..822,940..942,949..954,961..963)
Exon (1)1..757
Gene:HOXB13
Gene Synonym:PSGD
Exon (2)758..3038
Gene:HOXB13
Gene Synonym:PSGD
Translation MEPGNYATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPP KQCHPCPGVPQGTSPAPVPYGYFGGGYYSCRVSRSSLKPCAQAATLAAYPAETPTAGEEY PSRPTEFAFYPGYPGTYQPMASYLDVSVVQTLGAPGEPRHDSLLPVDSYQSWALAGGWNS QMCCQGEQNPPGPFWKAAFADSSGQHPPDACAFRRGRKKRIPYSKGQLRELEREYAANKF ITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVKNSATP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(8)-dbSNP:
complement(8)-g, adbSNP:147157748
complement(81)-t, cdbSNP:200066609
complement(110)-g, adbSNP:200891371
complement(116)-t, cdbSNP:61748976
complement(253)-t, gdbSNP:79344505
complement(278)-g, adbSNP:199799743
complement(301)-g, cdbSNP:11551892
complement(344)-t, cdbSNP:199813155
complement(407)-t, cdbSNP:138213197
complement(459)-g, cdbSNP:150413396
complement(470)-g, adbSNP:140492479
complement(486)-c, adbSNP:33993186
complement(522)-t, cdbSNP:8556
complement(524)-t, cdbSNP:201428095
complement(610)-t, gdbSNP:140373548
complement(630)-g, adbSNP:35033273
complement(645)-g, cdbSNP:199561305
complement(669)-g, adbSNP:9900627
complement(679)-c, adbSNP:148649390
complement(723)-g, adbSNP:143945091
complement(738)-g, adbSNP:201780092
complement(790)-dbSNP:
complement(790)-t, cdbSNP:145059285
complement(805)-g, adbSNP:139475791
complement(834)-t, cdbSNP:200362093
complement(891)-t, cdbSNP:138675188
complement(982)-t, cdbSNP:191886930
complement(988)-c, adbSNP:200997384
complement(1009)-, adbSNP:77179853
complement(1065)-g, cdbSNP:144967504
complement(1068)-t, cdbSNP:141179592
complement(1082)-t, gdbSNP:187442839
complement(1126)-t, cdbSNP:183620920
complement(1224)-g, cdbSNP:192244427
complement(1312)-g, adbSNP:2280353
complement(1330)-g, adbSNP:2280354
complement(1331)-g, adbSNP:146552906
complement(1454)-g, cdbSNP:79982443
complement(1532)-t, adbSNP:187003057
complement(1557)-t, cdbSNP:144241488
complement(1625)-t, cdbSNP:11653611
complement(1873)-g, adbSNP:113568340
complement(1902)-c, adbSNP:184053751
complement(1927)-g, adbSNP:79214867
complement(2168)-c, adbSNP:1056656
complement(2190)-t, cdbSNP:189589365
complement(2494)-t, cdbSNP:8069269
complement(2533)-t, cdbSNP:8069252
complement(2583)-g, adbSNP:8065051
complement(2602)-g, adbSNP:3107299
complement(2624)-g, cdbSNP:8081840
complement(2628)-g, adbSNP:8065028
complement(2630)-t, cdbSNP:142428986
complement(2751)-g, adbSNP:148791210
complement(2804)-t, cdbSNP:61123825
complement(2834)-t, cdbSNP:79812861
complement(2844)-g, cdbSNP:145426191
complement(2847)-t, gdbSNP:8068732
complement(2849)-t, gdbSNP:116931900
complement(2879)-c, adbSNP:8082520
complement(2934)-t, cdbSNP:8068566
complement(2984)-c, adbSNP:8064432
Gene SymbolHOXB13
Gene SynonymPSGD
Chromosome17
Locus Map17q21.2
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_006361 Homo sapiens homeobox B13 (HOXB13), mRNA. Full Length $1066.45
ORF Sequence $247.95
Title HOXB13 is a susceptibility gene for prostate cancer: results from the International Consortium for Prostate Cancer Genetics (ICPCG) .
Author Xu,J., Lange,E.M., Lu,L., Zheng,S.L., Wang,Z., Thibodeau,S.N., Cannon-Albright,L.A., Teerlink,C.C., Camp,N.J., Johnson,A.M., Zuhlke,K.A., Stanford,J.L., Ostrander,E.A., Wiley,K.E., Isaacs,S.D., Walsh,P.C., Maier,C., Luedeke,M., Vogel,W., Schleutker,J., Wahlfors,T., Tammela,T., Schaid,D., McDonnell,S.K., DeRycke,M.S., Cancel-Tassin,G., Cussenot,O., Wiklund,F., Gronberg,H., Eeles,R., Easton,D., Kote-Jarai,Z., Whittemore,A.S., Hsieh,C.L., Giles,G.G., Hopper,J.L., Severi,G., Catalona,W.J., Mandal,D., Ledet,E., Foulkes,W.D., Hamel,N., Mahle,L., Moller,P., Powell,I., Bailey-Wilson,J.E., Carpten,J.D., Seminara,D., Cooney,K.A. and Isaacs,W.B.
Journal Hum. Genet. 132 (1), 5-14 (2013)
Title A novel germline mutation in HOXB13 is associated with prostate cancer risk in Chinese men .
Author Lin,X., Qu,L., Chen,Z., Xu,C., Ye,D., Shao,Q., Wang,X., Qi,J., Chen,Z., Zhou,F., Wang,M., Wang,Z., He,D., Wu,D., Gao,X., Yuan,J., Wang,G., Xu,Y., Wang,G., Dong,P., Jiao,Y., Yang,J., Ou-Yang,J., Jiang,H., Zhu,Y., Ren,S., Zhang,Z., Yin,C., Wu,Q., Zheng,Y., Turner,A.R., Tao,S., Na,R., Ding,Q., Lu,D., Shi,R., Sun,J., Liu,F., Zheng,S.L., Mo,Z., Sun,Y. and Xu,J.
Journal Prostate 73 (2), 169-175 (2013)
Title Association between germline HOXB13 G84E mutation and risk of prostate cancer .
Author Akbari,M.R., Trachtenberg,J., Lee,J., Tam,S., Bristow,R., Loblaw,A., Narod,S.A. and Nam,R.K.
Journal J. Natl. Cancer Inst. 104 (16), 1260-1262 (2012)
Title Association of a HOXB13 variant with breast cancer .
Author Alanee,S., Couch,F. and Offit,K.
Journal N. Engl. J. Med. 367 (5), 480-481 (2012)
Title Confirmation of the HOXB13 G84E germline mutation in familial prostate cancer .
Author Breyer,J.P., Avritt,T.G., McReynolds,K.M., Dupont,W.D. and Smith,J.R.
Journal Cancer Epidemiol. Biomarkers Prev. 21 (8), 1348-1353 (2012)
Title HOXB13 homeodomain protein is cytoplasmic throughout fetal skin development .
Author Komuves,L.G., Ma,X.K., Stelnicki,E., Rozenfeld,S., Oda,Y. and Largman,C.
Journal Dev. Dyn. 227 (2), 192-202 (2003)
Title Complete mutation analysis panel of the 39 human HOX genes .
Author Kosaki,K., Kosaki,R., Suzuki,T., Yoshihashi,H., Takahashi,T., Sasaki,K., Tomita,M., McGinnis,W. and Matsuo,N.
Journal Teratology 65 (2), 50-62 (2002)
Title Modulation of the human homeobox genes PRX-2 and HOXB13 in scarless fetal wounds .
Author Stelnicki,E.J., Arbeit,J., Cass,D.L., Saner,C., Harrison,M. and Largman,C.
Journal J. Invest. Dermatol. 111 (1), 57-63 (1998)
Title AbdB-like Hox proteins stabilize DNA binding by the Meis1 homeodomain proteins .
Author Shen,W.F., Montgomery,J.C., Rozenfeld,S., Moskow,J.J., Lawrence,H.J., Buchberg,A.M. and Largman,C.
Journal Mol. Cell. Biol. 17 (11), 6448-6458 (1997)
Title Hoxb-13: a new Hox gene in a distant region of the HOXB cluster maintains colinearity .
Author Zeltser,L., Desplan,C. and Heintz,N.
Journal Development 122 (8), 2475-2484 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878