• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens 1-acylglycerol-3-phosphate O-acyltransferase 2 (AGPAT2), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu22397 Homo sapiens 1-acylglycerol-3-phosphate O-acyltransferase 2 (AGPAT2), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu22397C Homo sapiens 1-acylglycerol-3-phosphate O-acyltransferase 2 (AGPAT2), transcript variant 1, mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_006412.3, 68835055
Length 837 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens 1-acylglycerol-3-phosphate O-acyltransferase 2 (AGPAT2), transcript variant 1, mRNA.
Product 1-acyl-sn-glycerol-3-phosphate acyltransferase beta isoform a precursor
Comment

Summary: This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in this gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (a).

RefSeq NP_006403.2
CDS 103..939
Misc Feature(1)31..33
Misc Feature(2)31..33
Misc Feature(3)190..252
Misc Feature(4)301..849
Misc Feature(5)order(394..396,403..405,409..411,457..468,619..627)
Misc Feature(6)394..411
Misc Feature(7)466..528
Misc Feature(8)616..627
Misc Feature(9)661..723
Exon (1)1..284
Gene:AGPAT2
Gene Synonym:1-AGPAT2; BSCL; BSCL1; LPAAB; LPAAT-beta
Exon (2)285..418
Gene:AGPAT2
Gene Synonym:1-AGPAT2; BSCL; BSCL1; LPAAB; LPAAT-beta
Exon (3)419..594
Gene:AGPAT2
Gene Synonym:1-AGPAT2; BSCL; BSCL1; LPAAB; LPAAT-beta
Exon (4)595..690
Gene:AGPAT2
Gene Synonym:1-AGPAT2; BSCL; BSCL1; LPAAB; LPAAT-beta
Exon (5)691..763
Gene:AGPAT2
Gene Synonym:1-AGPAT2; BSCL; BSCL1; LPAAB; LPAAT-beta
Exon (6)764..1548
Gene:AGPAT2
Gene Synonym:1-AGPAT2; BSCL; BSCL1; LPAAB; LPAAT-beta
Translation MELWPCLAAALLLLLLLVQLSRAAEFYAKVALYCALCFTVSAVASLVCLLRHGGRTVENM SIIGWFVRSFKYFYGLRFEVRDPRRLQEARPCVIVSNHQSILDMMGLMEVLPERCVQIAK RELLFLGPVGLIMYLGGVFFINRQRSSTAMTVMADLGERMVRENLKVWIYPEGTRNDNGD LLPFKKGAFYLAVQAQVPIVPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAAD VPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPAQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(36)-g, cdbSNP:146341067
complement(60)-t, cdbSNP:368026568
complement(64..69)-, cgctccdbSNP:376582855
complement(85)-g, adbSNP:369999417
complement(101)-g, adbSNP:376390282
complement(139..140)-, gcadbSNP:77891680
complement(152..153)-, cagdbSNP:371175048
complement(153..154)-, cagdbSNP:201504151
complement(156)-t, cdbSNP:140553479
complement(205)-t, cdbSNP:138811198
complement(236)-g, adbSNP:375485327
complement(291)-dbSNP:
complement(291)-g, adbSNP:150180733
304+c, tdbSNP:104894093
complement(310)-c, adbSNP:140995132
complement(330)-g, adbSNP:369829233
complement(331)-g, adbSNP:151053652
complement(332)-t, cdbSNP:375796317
350+, cdbSNP:193920848
complement(352)-g, adbSNP:369342642
complement(371)-t, cdbSNP:142176861
complement(442)-dbSNP:
complement(442)-g, adbSNP:142145391
complement(447)-g, adbSNP:73668354
complement(448)-t, cdbSNP:371597242
complement(461)-t, cdbSNP:114782902
complement(463)-g, adbSNP:369878933
479..480+, tdbSNP:387906355
complement(486)-g, adbSNP:139719956
complement(507)-g, adbSNP:375478547
complement(510)-t, cdbSNP:145467496
complement(513)-g, adbSNP:149658120
complement(517)-c, adbSNP:372935354
520..522+, ttcdbSNP:387906356
complement(525)-g, cdbSNP:200664359
complement(531)-c, adbSNP:199768207
complement(534)-t, cdbSNP:145964203
complement(535)-t, g, adbSNP:55755415
complement(536)-t, cdbSNP:200070319
complement(563)-t, gdbSNP:150530734
complement(567)-g, adbSNP:186887807
complement(570)-t, cdbSNP:371738943
complement(571)-c, adbSNP:367594835
complement(577)-g, adbSNP:142993240
complement(578)-c, adbSNP:374919945
complement(585)-g, adbSNP:370441324
complement(589)-t, cdbSNP:200183102
complement(640)-dbSNP:
complement(640)-t, cdbSNP:373343259
complement(646)-g, adbSNP:139685001
672+a, cdbSNP:121908926
complement(686)-g, cdbSNP:373943261
complement(700)-dbSNP:
complement(700)-c, adbSNP:17855341
complement(706)-t, cdbSNP:372408400
complement(714)-g, adbSNP:369494015
complement(731)-g, adbSNP:377267603
complement(742)-t, cdbSNP:142248792
745+a, tdbSNP:121908925
complement(748)-t, adbSNP:138994150
complement(749)-t, adbSNP:143244920
complement(769)-g, cdbSNP:200073215
785+c, tdbSNP:104894100
complement(804)-g, adbSNP:116951119
complement(805)-t, cdbSNP:138232867
complement(815)-g, adbSNP:200656731
complement(816)-t, cdbSNP:370950858
complement(818)-g, adbSNP:145975461
complement(822)-g, adbSNP:142207711
823+a, g, tdbSNP:11545228
complement(834)-g, adbSNP:200288462
complement(843)-g, adbSNP:117434864
complement(849)-g, adbSNP:372240340
complement(851)-t, cdbSNP:368090654
complement(863)-g, adbSNP:147616533
complement(864)-g, adbSNP:146973799
complement(866)-g, adbSNP:141456385
complement(888)-t, gdbSNP:151215253
890+c, tdbSNP:17848858
complement(892)-g, adbSNP:373878123
complement(900)-g, adbSNP:370809970
complement(911)-g, adbSNP:142417583
complement(921)-g, adbSNP:373329785
complement(922)-t, cdbSNP:368902934
complement(949)-g, adbSNP:375808894
complement(950)-t, cdbSNP:372910163
complement(962)-t, gdbSNP:201868056
complement(970)-t, cdbSNP:368352508
complement(987)-g, adbSNP:200614462
complement(1018)-g, c, adbSNP:112657922
complement(1041)-g, adbSNP:144522710
complement(1096)-g, adbSNP:4880119
complement(1147)-g, adbSNP:55754159
complement(1148..1149)-, agcccgdbSNP:78572213
complement(1148..1149)-, agcccgdbSNP:398073596
complement(1150)-t, cdbSNP:182766891
complement(1155..1156)-, cgagccdbSNP:71675070
complement(1156..1157)-, cgagccdbSNP:145169122
complement(1157)-t, cdbSNP:371672236
complement(1169)-g, adbSNP:190437134
complement(1175)-g, adbSNP:117979028
complement(1178)-t, cdbSNP:56310643
complement(1224)-t, cdbSNP:372152756
complement(1304)-g, adbSNP:113127797
1381+c, gdbSNP:6951
complement(1449)-g, adbSNP:149296700
1456+c, tdbSNP:10320
complement(1474)-g, adbSNP:138670030
1502+a, cdbSNP:1061994
complement(1525..1526)-, adbSNP:112492508
Gene SymbolAGPAT2
Gene Synonym1-AGPAT2; BSCL; BSCL1; LPAAB; LPAAT-beta
Chromosome9
Locus Map9q34.3
Title MicroRNA-24 inhibits osteosarcoma cell proliferation both in vitro and in vivo by targeting LPAATbeta .
Author Song L, Yang J, Duan P, Xu J, Luo X, Luo F, Zhang Z, Hou T, Liu B and Zhou Q.
Journal Arch. Biochem. Biophys. 535 (2), 128-135 (2013)
Title Identification of a novel nonsense mutation and a missense substitution in the AGPAT2 gene causing congenital generalized lipodystrophy type 1 .
Author Haghighi A, Razzaghy-Azar M, Talea A, Sadeghian M, Ellard S and Haghighi A.
Journal Eur J Med Genet 55 (11), 620-624 (2012)
Title Alterations in lipid signaling underlie lipodystrophy secondary to AGPAT2 mutations .
Author Subauste AR, Das AK, Li X, Elliott BG, Evans C, El Azzouny M, Treutelaar M, Oral E, Leff T and Burant CF.
Journal Diabetes 61 (11), 2922-2931 (2012)
Title Human 1-acylglycerol-3-phosphate O-acyltransferase isoforms 1 and 2: biochemical characterization and inability to rescue hepatic steatosis in Agpat2(-/-) gene lipodystrophic mice .
Author Agarwal AK, Sukumaran S, Cortes VA, Tunison K, Mizrachi D, Sankella S, Gerard RD, Horton JD and Garg A.
Journal J. Biol. Chem. 286 (43), 37676-37691 (2011)
Title [Lysophosphatidic acid acyltransferase beta gene expression in newly diagnosed leukemia patients] .
Author Zhan R, Huang HB, Wu SQ and Lin J.
Journal Zhongguo Shi Yan Xue Ye Xue Za Zhi 18 (6), 1422-1426 (2010)
Title A human cDNA sequence with homology to non-mammalian lysophosphatidic acid acyltransferases .
Author Stamps AC, Elmore MA, Hill ME, Kelly K, Makda AA and Finnen MJ.
Journal Biochem. J. 326 (PT 2), 455-461 (1997)
Title Human lysophosphatidic acid acyltransferase. cDNA cloning, expression, and localization to chromosome 9q34.3 .
Author Eberhardt C, Gray PW and Tjoelker LW.
Journal J. Biol. Chem. 272 (32), 20299-20305 (1997)
Title Cloning and expression of two human lysophosphatidic acid acyltransferase cDNAs that enhance cytokine-induced signaling responses in cells .
Author West J, Tompkins CK, Balantac N, Nudelman E, Meengs B, White T, Bursten S, Coleman J, Kumar A, Singer JW and Leung DW.
Journal DNA Cell Biol. 16 (6), 691-701 (1997)
Title Biosynthesis of triacylglycerols .
Author Lehner R and Kuksis A.
Journal Prog. Lipid Res. 35 (2), 169-201 (1996)
Title Berardinelli-Seip Congenital Lipodystrophy .
Author Van Maldergem,L.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.