• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens solute carrier organic anion transporter family, member 1B1 (SLCO1B1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_006446 Homo sapiens solute carrier organic anion transporter family, member 1B1 (SLCO1B1), mRNA. GenEZ ORF Cloning In-stock $639.00 $590.00 15

*Business Day

Related Services

RefSeq Version NM_006446.4, 225543524
Length 2800 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens solute carrier organic anion transporter family, member 1B1 (SLCO1B1), mRNA.
Product solute carrier organic anion transporter family member 1B1
Comment

Summary: This gene encodes a liver-specific member of the organic anion transporter family. The encoded protein is a transmembrane receptor that mediates the sodium-independent uptake of numerous endogenous compounds including bilirubin, 17-beta-glucuronosyl estradiol and leukotriene C4. This protein is also involved in the removal of drug compounds such as statins, bromosulfophthalein and rifampin from the blood into the hepatocytes. Polymorphisms in the gene encoding this protein are associated with impaired transporter function. [provided by RefSeq, Mar 2009].

RefSeq NP_006437.3
CDS 105..2180
Misc Feature(1)1
Misc Feature(2)1
Misc Feature(3)45..47
Misc Feature(4)45..47
Misc Feature(5)183..1970
Misc Feature(6)183..1970
Misc Feature(7)189..248
Misc Feature(8)306..368
Misc Feature(9)387..461
Misc Feature(10)<600..>806
Misc Feature(11)609..695
Misc Feature(12)753..815
Misc Feature(13)870..944
Misc Feature(14)1098..1163
Misc Feature(15)1224..1295
Misc Feature(16)1308..1379
Misc Feature(17)1467..1628
Misc Feature(18)1716..1784
Misc Feature(19)1812..1889
Misc Feature(20)1992..2045
Exon (1)1..43
Gene:SLCO1B1
Gene Synonym:HBLRR; LST-1; LST1; OATP-C; OATP1B1; OATP2; OATPC; SLC21A6
Exon (2)44..188
Gene:SLCO1B1
Gene Synonym:HBLRR; LST-1; LST1; OATP-C; OATP1B1; OATP2; OATPC; SLC21A6
Exon (3)189..330
Gene:SLCO1B1
Gene Synonym:HBLRR; LST-1; LST1; OATP-C; OATP1B1; OATP2; OATPC; SLC21A6
Exon (4)331..463
Gene:SLCO1B1
Gene Synonym:HBLRR; LST-1; LST1; OATP-C; OATP1B1; OATP2; OATPC; SLC21A6
Exon (5)464..585
Gene:SLCO1B1
Gene Synonym:HBLRR; LST-1; LST1; OATP-C; OATP1B1; OATP2; OATPC; SLC21A6
Exon (6)586..732
Gene:SLCO1B1
Gene Synonym:HBLRR; LST-1; LST1; OATP-C; OATP1B1; OATP2; OATPC; SLC21A6
Exon (7)733..831
Gene:SLCO1B1
Gene Synonym:HBLRR; LST-1; LST1; OATP-C; OATP1B1; OATP2; OATPC; SLC21A6
Exon (8)832..1074
Gene:SLCO1B1
Gene Synonym:HBLRR; LST-1; LST1; OATP-C; OATP1B1; OATP2; OATPC; SLC21A6
Exon (9)1075..1239
Gene:SLCO1B1
Gene Synonym:HBLRR; LST-1; LST1; OATP-C; OATP1B1; OATP2; OATPC; SLC21A6
Exon (10)1240..1435
Gene:SLCO1B1
Gene Synonym:HBLRR; LST-1; LST1; OATP-C; OATP1B1; OATP2; OATPC; SLC21A6
Exon (11)1436..1601
Gene:SLCO1B1
Gene Synonym:HBLRR; LST-1; LST1; OATP-C; OATP1B1; OATP2; OATPC; SLC21A6
Exon (12)1602..1786
Gene:SLCO1B1
Gene Synonym:HBLRR; LST-1; LST1; OATP-C; OATP1B1; OATP2; OATPC; SLC21A6
Exon (13)1787..1851
Gene:SLCO1B1
Gene Synonym:HBLRR; LST-1; LST1; OATP-C; OATP1B1; OATP2; OATPC; SLC21A6
Exon (14)1852..1969
Gene:SLCO1B1
Gene Synonym:HBLRR; LST-1; LST1; OATP-C; OATP1B1; OATP2; OATPC; SLC21A6
Exon (15)1970..2787
Gene:SLCO1B1
Gene Synonym:HBLRR; LST-1; LST1; OATP-C; OATP1B1; OATP2; OATPC; SLC21A6
Translation MDQNQHLNKTAEAQPSENKKTRYCNGLKMFLAALSLSFIAKTLGAIIMKSSIIHIERRFE ISSSLVGFIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCFIMGIGGVLTALPHFFMGY YRYSKETNINSSENSTSTLSTCLINQILSLNRASPEIVGKGCLKESGSYMWIYVFMGNML RGIGETPIVPLGLSYIDDFAKEGHSSLYLGILNAIAMIGPIIGFTLGSLFSKMYVDIGYV DLSTIRITPTDSRWVGAWWLNFLVSGLFSIISSIPFFFLPQTPNKPQKERKASLSLHVLE TNDEKDQTANLTNQGKNITKNVTGFFQSFKSILTNPLYVMFVLLTLLQVSSYIGAFTYVF KYVEQQYGQPSSKANILLGVITIPIFASGMFLGGYIIKKFKLNTVGIAKFSCFTAVMSLS FYLLYFFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGIT YISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAI QVLNLFFSALGGTSHVMLIVKIVQPELKSLALGFHSMVIRALGGILAPIYFGALIDTTCI KWSTNNCGTRGSCRTYNSTSFSRVYLGLSSMLRVSSLVLYIILIYAMKKKYQEKDINASE NGSVMDEANLESLNKNKHFVPSAGADSETHC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
91+g, tdbSNP:201251518
102+a, cdbSNP:180888034
105+a, tdbSNP:185905373
108+a, gdbSNP:146133530
132+a, gdbSNP:11557087
134+a, gdbSNP:113635866
170+a, tdbSNP:142087529
183+c, tdbSNP:190581845
189+dbSNP:
189+a, gdbSNP:146317972
273+c, tdbSNP:139257324
274+a, gdbSNP:61760183
288+c, tdbSNP:144164853
314+c, tdbSNP:148697674
321+c, tdbSNP:56101265
349+dbSNP:
349+c, tdbSNP:56061388
359+c, tdbSNP:71581978
402+a, gdbSNP:144508550
421+c, tdbSNP:200227560
492+dbSNP:
492+c, tdbSNP:2306283
505+a, cdbSNP:202074496
514+c, tdbSNP:151204465
515+a, gdbSNP:11045818
523+c, tdbSNP:147450830
556+c, tdbSNP:2306282
559+c, gdbSNP:145144129
567+a, cdbSNP:11045819
571+a, gdbSNP:72559745
578+a, gdbSNP:140730264
589+dbSNP:
589+a, gdbSNP:138374684
622+a, gdbSNP:141467543
625+c, tdbSNP:4149056
645+c, tdbSNP:138965366
646+a, gdbSNP:142101690
663+c, gdbSNP:200331427
675+c, tdbSNP:4149057
682+g, tdbSNP:72559746
695+c, tdbSNP:148105486
701+c, tdbSNP:2291075
703+c, tdbSNP:150623527
712+a, gdbSNP:4603354
735+dbSNP:
735+a, cdbSNP:184348772
737+a, gdbSNP:201722521
766+a, tdbSNP:139691245
768+a, gdbSNP:79135870
807+a, gdbSNP:147421160
837+dbSNP:
837+a, gdbSNP:11045852
848+c, tdbSNP:145206027
861+c, tdbSNP:183501729
862+a, gdbSNP:11045853
912+a, cdbSNP:201438350
926+a, gdbSNP:192911820
938+c, gdbSNP:182303784
944+c, gdbSNP:199712476
945+, adbSNP:72559742
958+a, gdbSNP:148647456
986+a, gdbSNP:11045854
1002+a, gdbSNP:139907543
1068+g, tdbSNP:201363750
1085+dbSNP:
1085+g, tdbSNP:151155254
1104+a, tdbSNP:77871475
1111+c, gdbSNP:72559747
1116..1117+a, gdbSNP:61760245
1116..1117+, gtdbSNP:113495867
1138+c, tdbSNP:79109623
1139+a, gdbSNP:145167231
1147+a, gdbSNP:146867151
1162+a, c, tdbSNP:55901008
1180+c, tdbSNP:147750118
1184+c, gdbSNP:140674443
1190+c, tdbSNP:57040246
1290+dbSNP:
1290+a, cdbSNP:200621156
1304+c, gdbSNP:59113707
1330+a, gdbSNP:199859384
1350+c, gdbSNP:77468276
1352+a, gdbSNP:11045859
1376+a, cdbSNP:61176925
1393+g, tdbSNP:143266211
1398+a, g, tdbSNP:56387224
1412+c, tdbSNP:139049237
1413+a, gdbSNP:142965323
1420+a, cdbSNP:147437035
1423+g, tdbSNP:139797371
1426+a, cdbSNP:141779296
1431+c, gdbSNP:150573622
1489+dbSNP:
1489+a, gdbSNP:72559748
1556+c, tdbSNP:74064211
1560+a, cdbSNP:202110446
1567+c, gdbSNP:59502379
1569+a, tdbSNP:144733213
1582+a, gdbSNP:145491008
1599+a, gdbSNP:74064213
1636+dbSNP:
1636+a, gdbSNP:200319276
1668+a, gdbSNP:112909948
1670+a, tdbSNP:143973124
1677+c, tdbSNP:71581987
1693+a, gdbSNP:184762532
1726+a, tdbSNP:71581988
1732+g, tdbSNP:72661137
1745+c, gdbSNP:200158405
1796+dbSNP:
1796+a, tdbSNP:146415464
1819+c, tdbSNP:201987253
1828+a, tdbSNP:74700754
1836+c, gdbSNP:201001269
1842+c, tdbSNP:71581941
1884+dbSNP:
1884+c, tdbSNP:199945870
1888+c, tdbSNP:139026094
1897+c, tdbSNP:201861991
1898+a, gdbSNP:201556175
1913+c, gdbSNP:143812591
1981+dbSNP:
1981+a, tdbSNP:183624077
1982+c, gdbSNP:200526972
2014+a, tdbSNP:112560299
2033+a, cdbSNP:34671512
2068+a, g, tdbSNP:56199088
2104+a, gdbSNP:55737008
2136+c, tdbSNP:200995543
2144+a, cdbSNP:200467000
2149+c, tdbSNP:140790673
2161+a, gdbSNP:201158567
2199+g, tdbSNP:113870212
2220+c, gdbSNP:79775553
2226+g, tdbSNP:71581985
2238+a, gdbSNP:113192433
2262+a, c, g, tdbSNP:72655363
2301+c, gdbSNP:74064260
2347+c, tdbSNP:4149085
2389+g, tdbSNP:201787919
2508+a, gdbSNP:4149086
2585+c, tdbSNP:112204127
2619+g, tdbSNP:4149087
2629+a, cdbSNP:11045891
2643+a, gdbSNP:4149088
2661+c, tdbSNP:71581986
2755+a, g, tdbSNP:61760249
2785+a, cdbSNP:141979092
Gene SymbolSLCO1B1
Gene SynonymHBLRR; LST-1; LST1; OATP-C; OATP1B1; OATP2; OATPC; SLC21A6
Chromosome12
Locus Map12p
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006446 Homo sapiens solute carrier organic anion transporter family, member 1B1 (SLCO1B1), mRNA. In-stock $639.00 $590.00 15
Title Impact of OATP1B1, MDR1, and CYP3A4 expression in liver and intestine on interpatient pharmacokinetic variability of atorvastatin in obese subjects .
Author Ulvestad,M., Skottheim,I.B., Jakobsen,G.S., Bremer,S., Molden,E., Asberg,A., Hjelmesaeth,J., Andersson,T.B., Sandbu,R. and Christensen,H.
Journal Clin. Pharmacol. Ther. 93 (3), 275-282 (2013)
Title Genome-wide study of methotrexate clearance replicates SLCO1B1 .
Author Ramsey,L.B., Panetta,J.C., Smith,C., Yang,W., Fan,Y., Winick,N.J., Martin,P.L., Cheng,C., Devidas,M., Pui,C.H., Evans,W.E., Hunger,S.P., Loh,M. and Relling,M.V.
Journal Blood 121 (6), 898-904 (2013)
Title Contribution of the OATP1B subfamily to cancer biology and treatment .
Author Sissung,T.M., Reece,K.M., Spencer,S. and Figg,W.D.
Journal Clin. Pharmacol. Ther. 92 (5), 658-660 (2012)
Title Characterization of the human OATP-C (SLC21A6) gene promoter and regulation of liver-specific OATP genes by hepatocyte nuclear factor 1 alpha .
Author Jung,D., Hagenbuch,B., Gresh,L., Pontoglio,M., Meier,P.J. and Kullak-Ublick,G.A.
Journal J. Biol. Chem. 276 (40), 37206-37214 (2001)
Title Hepatic uptake of bilirubin and its conjugates by the human organic anion transporter SLC21A6 .
Author Cui,Y., Konig,J., Leier,I., Buchholz,U. and Keppler,D.
Journal J. Biol. Chem. 276 (13), 9626-9630 (2001)
Title Localization and genomic organization of a new hepatocellular organic anion transporting polypeptide .
Author Konig,J., Cui,Y., Nies,A.T. and Keppler,D.
Journal J. Biol. Chem. 275 (30), 23161-23168 (2000)
Title Molecular identification and characterization of novel members of the human organic anion transporter (OATP) family .
Author Tamai,I., Nezu,J., Uchino,H., Sai,Y., Oku,A., Shimane,M. and Tsuji,A.
Journal Biochem. Biophys. Res. Commun. 273 (1), 251-260 (2000)
Title A novel human organic anion transporting polypeptide localized to the basolateral hepatocyte membrane .
Author Konig,J., Cui,Y., Nies,A.T. and Keppler,D.
Journal Am. J. Physiol. Gastrointest. Liver Physiol. 278 (1), G156-G164 (2000)
Title A novel human hepatic organic anion transporting polypeptide (OATP2). Identification of a liver-specific human organic anion transporting polypeptide and identification of rat and human hydroxymethylglutaryl-CoA reductase inhibitor transporters .
Author Hsiang,B., Zhu,Y., Wang,Z., Wu,Y., Sasseville,V., Yang,W.P. and Kirchgessner,T.G.
Journal J. Biol. Chem. 274 (52), 37161-37168 (1999)
Title Identification of a novel gene family encoding human liver-specific organic anion transporter LST-1 .
Author Abe,T., Kakyo,M., Tokui,T., Nakagomi,R., Nishio,T., Nakai,D., Nomura,H., Unno,M., Suzuki,M., Naitoh,T., Matsuno,S. and Yawo,H.
Journal J. Biol. Chem. 274 (24), 17159-17163 (1999)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.