• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ALX homeobox 3 (ALX3), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19546 Homo sapiens ALX homeobox 3 (ALX3), mRNA. pcDNA3.1+-DYK On-demand TBD TBD
OHu19546C Homo sapiens ALX homeobox 3 (ALX3), mRNA. Customized vector On-demand $269.00 TBD

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_006492.2, 113204603
Length 1032 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens ALX homeobox 3 (ALX3), mRNA.
Product homeobox protein aristaless-like 3
Comment

Summary: This gene encodes a nuclear protein with a homeobox DNA-binding domain that functions as a transcriptional regulator involved in cell-type differentiation and development. Preferential methylation of this gene's promoter is associated with advanced-stage neuroblastoma tumors. [provided by RefSeq, Jul 2008].


##Evidence-Data-START## Transcript exon combination :: BC113428.1, BC112007.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025087 [ECO:0000348] ##Evidence-Data-END##

RefSeq NP_006483.2
CDS 89..1120
Misc Feature(1)80..82
Misc Feature(2)80..82
Misc Feature(3)548..724
Misc Feature(4)548..724
Misc Feature(5)order(548..562,566..568,617..619,635..637,674..676,
Misc Feature(6)order(554..556,563..565,683..685,692..697,704..706)
Exon (1)366..682
Gene:ALX3
Gene Synonym:FND; FND1
Exon (2)683..811
Gene:ALX3
Gene Synonym:FND; FND1
Exon (3)812..1478
Gene:ALX3
Gene Synonym:FND; FND1
Translation MDPEHCAPFRVGPAPGPYVASGDEPPGPQGTPAAAPHLHPAPPRGPRLTRFPACGPLEPY LPEPAKPPAKYLQDLGPGPALNGGHFYEGPAEAEEKTSKAASFPQLPLDCRGGPRDGPSN LQGSPGPCLASLHLPLSPGLPDSMELAKNKSKKRRNRTTFSTFQLEELEKVFQKTHYPDV YAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKIQEGRNPFTAAYDISVLPRTDSHP QLQNSLWASPGSGSPGGPCLVSPEGIPSPCMSPYSHPHGSVAGFMGVPAPSAAHPGIYSI HGFPPTLGGHSFEPSSDGDYKSPSLVSLRVKPKEPPGLLNWTT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(243)-g, adbSNP:375790592
complement(279)-g, adbSNP:372506798
complement(290)-g, cdbSNP:12756321
complement(326)-g, cdbSNP:113980045
complement(346)-g, adbSNP:842021
complement(394)-g, adbSNP:146519121
complement(434)-g, cdbSNP:372198014
complement(435)-t, cdbSNP:373683008
complement(436)-g, adbSNP:146795178
complement(437)-t, cdbSNP:138645472
complement(453)-t, cdbSNP:111275942
complement(473)-g, adbSNP:139794205
complement(476)-g, cdbSNP:75373920
complement(502)-t, cdbSNP:150660098
complement(504)-t, cdbSNP:199713385
complement(519)-g, adbSNP:368492786
complement(525)-c, adbSNP:200156688
complement(557)-g, adbSNP:375422680
complement(568)-g, adbSNP:147534614
complement(569)-t, cdbSNP:143366374
complement(576)-g, adbSNP:201420718
590+c, gdbSNP:121908167
complement(595)-t, cdbSNP:202179649
631+a, tdbSNP:121908169
635+c, tdbSNP:121908168
complement(654)-t, cdbSNP:199983753
666..669+, ctgadbSNP:387906319
674+c, tdbSNP:121908170
complement(675)-c, adbSNP:112456669
696+dbSNP:
696+a, gdbSNP:121908166
complement(699)-t, cdbSNP:374651713
complement(702)-t, cdbSNP:705279
complement(715)-t, cdbSNP:113851340
complement(726)-t, cdbSNP:150129126
complement(732)-g, cdbSNP:201764848
complement(750)-t, cdbSNP:375503292
complement(752)-t, adbSNP:370985645
complement(763)-t, cdbSNP:186135023
complement(765)-g, adbSNP:140822231
complement(777)-c, adbSNP:199801560
complement(788)-g, cdbSNP:12749726
complement(791)-g, adbSNP:145535704
complement(792)-t, cdbSNP:199753639
complement(823)-dbSNP:
complement(823)-g, cdbSNP:375181985
complement(836)-g, cdbSNP:145995775
complement(917)-t, gdbSNP:189671232
complement(919)-g, adbSNP:142284688
complement(957)-g, cdbSNP:372079233
complement(963)-g, adbSNP:145253023
complement(964)-t, cdbSNP:370347653
complement(985)-g, adbSNP:200860667
complement(1003)-g, adbSNP:34775503
complement(1007)-, gdbSNP:397863738
complement(1047)-t, cdbSNP:376262878
complement(1065)-g, adbSNP:373342900
complement(1069)-t, cdbSNP:139199337
complement(1086)-t, gdbSNP:141042736
complement(1092)-g, adbSNP:369347396
complement(1096)-g, adbSNP:35010218
complement(1110)-t, cdbSNP:201913545
complement(1117)-t, cdbSNP:372987570
complement(1123)-t, c, adbSNP:199646849
complement(1124)-t, cdbSNP:199955428
complement(1177..1178)-, ctgggdbSNP:71580516
complement(1183)-c, adbSNP:201416320
complement(1184..1185)-, ggdbSNP:57429950
complement(1187..1188)-, ggtgcttcctccgtggtgtccaggcaggdbSNP:139173949
complement(1188..1189)-, ggtgcttcctccgtggtgtccaggcaggdbSNP:144523285
complement(1189)-g, adbSNP:4520416
complement(1206)-g, cdbSNP:9792865
complement(1211..1212)-, cttcctccgtggtgtccaggcaggggtgdbSNP:150626565
complement(1261)-t, g, adbSNP:12042664
complement(1303)-t, cdbSNP:181219574
complement(1329)-t, cdbSNP:116760307
complement(1355)-g, adbSNP:45610035
complement(1375)-g, cdbSNP:188259441
complement(1432)-g, cdbSNP:1027463
Gene SymbolALX3
Gene SynonymFND; FND1
Chromosome1
Locus Map1p13.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006492 Homo sapiens ALX homeobox 3 (ALX3), mRNA. On-demand TBD TBD
Title Exclusion of mutations in TGIF, ALX3, and ALX4 genes in patients with the syndrome of frontonasal dysgenesis, callosal agenesis, basal encephalocele, and eye anomalies .
Author Ribeiro-Bicudo LA, Quiezi RG, Guion-Almeida ML, Legnaro C and Richieri-Costa A.
Journal Am. J. Med. Genet. A 158A (5), 1233-1235 (2012)
Title Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women .
Author Fox CS, Liu Y, White CC, Feitosa M, Smith AV, Heard-Costa N, Lohman K, Johnson AD, Foster MC, Greenawalt DM, Griffin P, Ding J, Newman AB, Tylavsky F, Miljkovic I, Kritchevsky SB, Launer L, Garcia M, Eiriksdottir G, Carr JJ, Gudnason V, Harris TB, Cupples LA and Borecki IB.
Journal PLoS Genet. 8 (5), E1002695 (2012)
Title Clinical and genetic characterization of frontorhiny: report of 3 novel cases and discussion of the surgical management .
Author Pham NS, Rafii A, Liu J, Boyadjiev SA and Tollefson TT.
Journal Arch Facial Plast Surg 13 (6), 415-420 (2011)
Title Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia .
Author Jugessur A, Shi M, Gjessing HK, Lie RT, Wilcox AJ, Weinberg CR, Christensen K, Boyles AL, Daack-Hirsch S, Nguyen TT, Christiansen L, Lidral AC and Murray JC.
Journal PLoS ONE 5 (7), E11493 (2010)
Title Frontorhiny, a distinctive presentation of frontonasal dysplasia caused by recessive mutations in the ALX3 homeobox gene .
Author Twigg SR, Versnel SL, Nurnberg G, Lees MM, Bhat M, Hammond P, Hennekam RC, Hoogeboom AJ, Hurst JA, Johnson D, Robinson AA, Scambler PJ, Gerrelli D, Nurnberg P, Mathijssen IM and Wilkie AO.
Journal Am. J. Hum. Genet. 84 (5), 698-705 (2009)
Title The homeoprotein Alx3 expressed in pancreatic beta-cells regulates insulin gene transcription by interacting with the basic helix-loop-helix protein E47 .
Author Mirasierra M and Vallejo M.
Journal Mol. Endocrinol. 20 (11), 2876-2889 (2006)
Title The homeoprotein Alx3 contains discrete functional domains and exhibits cell-specific and selective monomeric binding and transactivation .
Author Perez-Villamil B, Mirasierra M and Vallejo M.
Journal J. Biol. Chem. 279 (36), 38062-38071 (2004)
Title Combined restriction landmark genomic scanning and virtual genome scans identify a novel human homeobox gene, ALX3, that is hypermethylated in neuroblastoma .
Author Wimmer K, Zhu Xx XX, Rouillard JM, Ambros PF, Lamb BJ, Kuick R, Eckart M, Weinhausl A, Fonatsch C and Hanash SM.
Journal Genes Chromosomes Cancer 33 (3), 285-294 (2002)
Title Pancreatic beta cells express a diverse set of homeobox genes .
Author Rudnick A, Ling TY, Odagiri H, Rutter WJ and German MS.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (25), 12203-12207 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.