• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 (GNAI3), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19778 Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 (GNAI3), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu19778C Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 (GNAI3), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_006496.3, 391224482
Length 1065 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 (GNAI3), mRNA.
Product guanine nucleotide-binding protein G(k) subunit alpha
Comment

Summary: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling pathways. G proteins are composed of 3 units: alpha, beta and gamma. This gene encodes an alpha subunit and belongs to the G-alpha family. Mutation in this gene, resulting in a gly40-to-arg substitution, is associated with auriculocondylar syndrome, and shown to affect downstream targets in the G protein-coupled endothelin receptor pathway. [provided by RefSeq, Jun 2012].

RefSeq NP_006487.1
CDS 158..1222
Misc Feature(1)122..124
Misc Feature(2)197..1213
Misc Feature(3)197..1213
Misc Feature(4)257..1201
Misc Feature(5)order(275..277,290..298,698..700,755..757,764..766,
Misc Feature(6)275..298
Misc Feature(7)order(278..286,368..370,380..382,392..394,401..403,
Misc Feature(8)362..364
Misc Feature(9)683..709
Misc Feature(10)698..700
Misc Feature(11)order(701..703,707..709,713..715,746..748,752..754,
Misc Feature(12)order(707..709,782..784,791..796,803..805)
Misc Feature(13)755..766
Misc Feature(14)758..808
Misc Feature(15)962..973
Misc Feature(16)order(1106..1141,1145..1156)
Misc Feature(17)1130..1138
Exon (1)1..275
Gene:GNAI3
Gene Synonym:87U6; ARCND1
Exon (2)276..318
Gene:GNAI3
Gene Synonym:87U6; ARCND1
Exon (3)319..460
Gene:GNAI3
Gene Synonym:87U6; ARCND1
Exon (4)461..618
Gene:GNAI3
Gene Synonym:87U6; ARCND1
Exon (5)619..747
Gene:GNAI3
Gene Synonym:87U6; ARCND1
Exon (6)748..877
Gene:GNAI3
Gene Synonym:87U6; ARCND1
Exon (7)878..1031
Gene:GNAI3
Gene Synonym:87U6; ARCND1
Exon (8)1032..1244
Gene:GNAI3
Gene Synonym:87U6; ARCND1
Exon (9)1245..4743
Gene:GNAI3
Gene Synonym:87U6; ARCND1
Translation MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG YSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT PELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVK TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM NRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(86)-dbSNP:
complement(86)-g, adbSNP:3737182
97+c, tdbSNP:1279195
102+a, cdbSNP:144431312
116+c, tdbSNP:372762722
120+a, cdbSNP:377520206
127+a, cdbSNP:375525670
128+c, tdbSNP:369464383
134+c, tdbSNP:373043112
139+a, cdbSNP:377287472
145+c, tdbSNP:200688916
148+c, tdbSNP:374285132
154+c, tdbSNP:3814308
220+a, c, gdbSNP:35781978
238+a, gdbSNP:143476268
262+a, gdbSNP:2230350
271+a, gdbSNP:375050746
275+c, gdbSNP:387907178
298+dbSNP:
298+a, cdbSNP:397514768
335+dbSNP:
335+a, gdbSNP:377596642
360+a, gdbSNP:142991217
407+a, gdbSNP:146129509
425+c, tdbSNP:145097404
426+a, gdbSNP:138850957
430+a, gdbSNP:370535951
442+c, tdbSNP:147658026
471+dbSNP:
471+a, gdbSNP:371540739
488+a, gdbSNP:11558725
544+c, g, tdbSNP:12721540
557+a, gdbSNP:142294586
complement(658)-dbSNP:
complement(658)-t, gdbSNP:11558723
666+c, tdbSNP:61754626
745+c, tdbSNP:199684276
747+a, gdbSNP:369731340
868+dbSNP:
868+c, tdbSNP:376480817
945+dbSNP:
945+c, gdbSNP:370566993
947+a, gdbSNP:61758986
1006+a, gdbSNP:369168058
1040+dbSNP:
1040+a, gdbSNP:112547520
1144+a, gdbSNP:61758987
1185+a, tdbSNP:138513964
1192+a, gdbSNP:143871630
1244+a, gdbSNP:369528637
1249+dbSNP:
1249+a, tdbSNP:188828094
1448+c, tdbSNP:192569717
1480+a, cdbSNP:184373268
1548+c, tdbSNP:114706827
1549+c, tdbSNP:72987047
1564+c, tdbSNP:372746665
1586+a, gdbSNP:7371
1586+a, gdbSNP:111155096
1606+a, gdbSNP:368914083
1662+a, cdbSNP:189839861
1720+a, gdbSNP:148596284
1789+a, gdbSNP:191918287
1799+c, gdbSNP:75351728
2020+a, gdbSNP:115879755
2027+c, gdbSNP:41280244
2212+c, tdbSNP:376641682
2269+c, gdbSNP:372739643
2361+a, tdbSNP:116444657
2384+a, gdbSNP:184476515
2409+a, tdbSNP:142981211
2429+a, tdbSNP:189181690
2453+c, tdbSNP:181671309
2507+a, gdbSNP:186301843
2546+g, tdbSNP:190395214
2579+a, tdbSNP:373132580
2594+a, gdbSNP:41280246
complement(2601..2602)-, atdbSNP:3833901
2703+a, gdbSNP:3204436
2711+c, tdbSNP:140944776
complement(2736)-t, cdbSNP:2301230
2747+g, tdbSNP:144806197
2799+a, gdbSNP:113638529
2854+, adbSNP:34068100
2919+a, tdbSNP:41280248
2956+a, gdbSNP:386502532
complement(2956)-g, adbSNP:2301229
3086+a, gdbSNP:147910367
3124+a, tdbSNP:3525
3140+g, tdbSNP:3210226
3162+c, tdbSNP:41280328
3216..3217+, adbSNP:144920545
3328+g, tdbSNP:74113946
3356+a, cdbSNP:371259422
3413+a, gdbSNP:191352660
3545..3546+, gadbSNP:375213420
3547..3555+, tttttttttdbSNP:71069696
3570+, tdbSNP:34268993
3570+, tttttttttdbSNP:397981181
3592+a, gdbSNP:140495181
3650+g, tdbSNP:182621710
3728+a, gdbSNP:113282866
3730+a, gdbSNP:185552804
3739+a, gdbSNP:7542287
3782+c, gdbSNP:367943869
3940+a, gdbSNP:190355785
3963+c, tdbSNP:182924003
4029+a, gdbSNP:116735976
4034+a, cdbSNP:188876501
4115+a, gdbSNP:74113947
4174+a, gdbSNP:74569545
4241+a, tdbSNP:79393283
4305+g, tdbSNP:193161151
4387+c, tdbSNP:11810577
4401+a, tdbSNP:144905386
4683+g, tdbSNP:367841339
4723+a, cdbSNP:182823545
4730..4731+, adbSNP:35421835
4743+a, tdbSNP:79958551
Gene SymbolGNAI3
Gene Synonym87U6; ARCND1
Chromosome1
Locus Map1p13
Title Evidence for dynein and astral microtubule-mediated cortical release and transport of Galphai/LGN/NuMA complex in mitotic cells .
Author Zheng Z, Wan Q, Liu J, Zhu H, Chu X and Du Q.
Journal Mol. Biol. Cell 24 (7), 901-913 (2013)
Title A human homeotic transformation resulting from mutations in PLCB4 and GNAI3 causes auriculocondylar syndrome .
Author Rieder MJ, Green GE, Park SS, Stamper BD, Gordon CT, Johnson JM, Cunniff CM, Smith JD, Emery SB, Lyonnet S, Amiel J, Holder M, Heggie AA, Bamshad MJ, Nickerson DA, Cox TC, Hing AV, Horst JA and Cunningham ML.
Journal Am. J. Hum. Genet. 90 (5), 907-914 (2012)
Title Two distinct aspects of coupling between Galpha(i) protein and G protein-activated K+ channel (GIRK) revealed by fluorescently labeled Galpha(i3) protein subunits .
Author Berlin S, Tsemakhovich VA, Castel R, Ivanina T, Dessauer CW, Keren-Raifman T and Dascal N.
Journal J. Biol. Chem. 286 (38), 33223-33235 (2011)
Title A GDI (AGS3) and a GEF (GIV) regulate autophagy by balancing G protein activity and growth factor signals .
Author Garcia-Marcos M, Ear J, Farquhar MG and Ghosh P.
Journal Mol. Biol. Cell 22 (5), 673-686 (2011)
Title Specific interaction of Galphai3 with the Oa1 G-protein coupled receptor controls the size and density of melanosomes in retinal pigment epithelium .
Author Young A, Jiang M, Wang Y, Ahmedli NB, Ramirez J, Reese BE, Birnbaumer L and Farber DB.
Journal PLoS ONE 6 (9), E24376 (2011)
Title Guanine nucleotide-binding regulatory proteins in retinal pigment epithelial cells .
Author Jiang M, Pandey S, Tran VT and Fong HK.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (9), 3907-3911 (1991)
Title Distinct guanine nucleotide binding and release properties of the three Gi proteins .
Author Carty DJ, Padrell E, Codina J, Birnbaumer L, Hildebrandt JD and Iyengar R.
Journal J. Biol. Chem. 265 (11), 6268-6273 (1990)
Title Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs .
Author Itoh H, Toyama R, Kozasa T, Tsukamoto T, Matsuoka M and Kaziro Y.
Journal J. Biol. Chem. 263 (14), 6656-6664 (1988)
Title Alpha i-3 cDNA encodes the alpha subunit of Gk, the stimulatory G protein of receptor-regulated K+ channels .
Author Codina J, Olate J, Abramowitz J, Mattera R, Cook RG and Birnbaumer L.
Journal J. Biol. Chem. 263 (14), 6746-6750 (1988)
Title The human genome encodes at least three non-allellic G proteins with alpha i-type subunits .
Author Suki,W.N., Abramowitz,J., Mattera,R., Codina,J. and Birnbaumer,L.
Journal FEBS Lett. 220 (1), 187-192 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.