• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 (GNAI3), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_006496 Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 (GNAI3), mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_006496.3, 391224482
Length 4748 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 (GNAI3), mRNA.
Product guanine nucleotide-binding protein G(k) subunit alpha
Comment

Summary: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling pathways. G proteins are composed of 3 units: alpha, beta and gamma. This gene encodes an alpha subunit and belongs to the G-alpha family. Mutation in this gene, resulting in a gly40-to-arg substitution, is associated with auriculocondylar syndrome, and shown to affect downstream targets in the G protein-coupled endothelin receptor pathway. [provided by RefSeq, Jun 2012].

RefSeq NP_006487.1
CDS 158..1222
Misc Feature(1)122..124
Misc Feature(2)197..1213
Misc Feature(3)197..1213
Misc Feature(4)287..1201
Misc Feature(5)287..298
Misc Feature(6)order(290..298,698..700,755..757,764..766,962..967,
Misc Feature(7)362..364
Misc Feature(8)order(368..370,380..382,392..394,401..403,410..415,
Misc Feature(9)683..709
Misc Feature(10)698..700
Misc Feature(11)order(701..703,707..709,713..715,746..748,752..754,
Misc Feature(12)order(707..709,782..784,791..796,803..805)
Misc Feature(13)755..766
Misc Feature(14)758..808
Misc Feature(15)962..973
Misc Feature(16)order(1106..1141,1145..1156)
Misc Feature(17)1130..1138
Exon (1)1..275
Gene:GNAI3
Gene Synonym:87U6; ARCND1
Exon (2)276..318
Gene:GNAI3
Gene Synonym:87U6; ARCND1
Exon (3)319..460
Gene:GNAI3
Gene Synonym:87U6; ARCND1
Exon (4)461..618
Gene:GNAI3
Gene Synonym:87U6; ARCND1
Exon (5)619..747
Gene:GNAI3
Gene Synonym:87U6; ARCND1
Exon (6)748..877
Gene:GNAI3
Gene Synonym:87U6; ARCND1
Exon (7)878..1031
Gene:GNAI3
Gene Synonym:87U6; ARCND1
Exon (8)1032..1244
Gene:GNAI3
Gene Synonym:87U6; ARCND1
Exon (9)1245..4743
Gene:GNAI3
Gene Synonym:87U6; ARCND1
Translation MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG YSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT PELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVK TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM NRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
86+dbSNP:
86+a, gdbSNP:3737182
97+c, tdbSNP:1279195
102+a, cdbSNP:144431312
145+c, tdbSNP:200688916
154+c, tdbSNP:3814308
220+a, c, gdbSNP:35781978
238+a, gdbSNP:143476268
262+a, gdbSNP:2230350
360+dbSNP:
360+a, gdbSNP:142991217
407+a, gdbSNP:146129509
425+c, tdbSNP:145097404
426+a, gdbSNP:138850957
442+c, tdbSNP:147658026
488+dbSNP:
488+a, gdbSNP:11558725
544+c, g, tdbSNP:12721540
557+a, gdbSNP:142294586
658+dbSNP:
658+g, tdbSNP:11558723
666+c, tdbSNP:61754626
745+c, tdbSNP:199684276
947+dbSNP:
947+a, gdbSNP:61758986
1040+dbSNP:
1040+a, gdbSNP:112547520
1144+a, gdbSNP:61758987
1185+a, tdbSNP:138513964
1192+a, gdbSNP:143871630
1249+dbSNP:
1249+a, tdbSNP:188828094
1448+c, tdbSNP:192569717
1480+a, cdbSNP:184373268
1548+c, tdbSNP:114706827
1549+c, tdbSNP:72987047
1586+a, gdbSNP:7371
1662+a, cdbSNP:189839861
1720+a, gdbSNP:148596284
1789+a, gdbSNP:191918287
1799+c, gdbSNP:75351728
2020+a, gdbSNP:115879755
2027+c, gdbSNP:41280244
2361+a, tdbSNP:116444657
2384+a, gdbSNP:184476515
2409+a, tdbSNP:142981211
2429+a, tdbSNP:189181690
2453+c, tdbSNP:181671309
2507+a, gdbSNP:186301843
2546+g, tdbSNP:190395214
2594+a, gdbSNP:41280246
2601..2602+, atdbSNP:3833901
2602..2603+, atdbSNP:72502381
2703+a, gdbSNP:3204436
2711+c, tdbSNP:140944776
2736+c, tdbSNP:2301230
2747+g, tdbSNP:144806197
2799+a, gdbSNP:113638529
2854+, adbSNP:34068100
2919+a, tdbSNP:41280248
2956+a, gdbSNP:2301229
3086+a, gdbSNP:147910367
3124+a, tdbSNP:3525
3140+g, tdbSNP:3210226
3162+c, tdbSNP:41280328
3215..3216+, adbSNP:144920545
3328+g, tdbSNP:74113946
3413+a, gdbSNP:191352660
3547..3555+, tttttttttdbSNP:71069696
3547+, t, ttdbSNP:34268993
3556+, tt, tttttttttdbSNP:10538914
3592+a, gdbSNP:140495181
3650+g, tdbSNP:182621710
3728+a, gdbSNP:113282866
3730+a, gdbSNP:185552804
3739+a, gdbSNP:7542287
3940+a, gdbSNP:190355785
3963+c, tdbSNP:182924003
4029+a, gdbSNP:116735976
4034+a, cdbSNP:188876501
4115+a, gdbSNP:74113947
4174+a, gdbSNP:74569545
4241+a, tdbSNP:79393283
4305+g, tdbSNP:193161151
4387+c, tdbSNP:11810577
4401+a, tdbSNP:144905386
4723+a, cdbSNP:182823545
4730..4731+, adbSNP:35421835
4731..4732+, adbSNP:148129124
4743+a, tdbSNP:79958551
Gene SymbolGNAI3
Gene Synonym87U6; ARCND1
Chromosome1
Locus Map1p13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006496 Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 (GNAI3), mRNA. In-stock $418.00 $369.00 10
Title A human homeotic transformation resulting from mutations in PLCB4 and GNAI3 causes auriculocondylar syndrome .
Author Rieder,M.J., Green,G.E., Park,S.S., Stamper,B.D., Gordon,C.T., Johnson,J.M., Cunniff,C.M., Smith,J.D., Emery,S.B., Lyonnet,S., Amiel,J., Holder,M., Heggie,A.A., Bamshad,M.J., Nickerson,D.A., Cox,T.C., Hing,A.V., Horst,J.A. and Cunningham,M.L.
Journal Am. J. Hum. Genet. 90 (5), 907-914 (2012)
Title Two distinct aspects of coupling between Galpha(i) protein and G protein-activated K+ channel (GIRK) revealed by fluorescently labeled Galpha(i3) protein subunits .
Author Berlin,S., Tsemakhovich,V.A., Castel,R., Ivanina,T., Dessauer,C.W., Keren-Raifman,T. and Dascal,N.
Journal J. Biol. Chem. 286 (38), 33223-33235 (2011)
Title A GDI (AGS3) and a GEF (GIV) regulate autophagy by balancing G protein activity and growth factor signals .
Author Garcia-Marcos,M., Ear,J., Farquhar,M.G. and Ghosh,P.
Journal Mol. Biol. Cell 22 (5), 673-686 (2011)
Title Specific interaction of Galphai3 with the Oa1 G-protein coupled receptor controls the size and density of melanosomes in retinal pigment epithelium .
Author Young,A., Jiang,M., Wang,Y., Ahmedli,N.B., Ramirez,J., Reese,B.E., Birnbaumer,L. and Farber,D.B.
Journal PLoS ONE 6 (9), E24376 (2011)
Title TNFAIP8: a new effector for Galpha(i) coupling to reduce cell death and induce cell transformation .
Author Laliberte,B., Wilson,A.M., Nafisi,H., Mao,H., Zhou,Y.Y., Daigle,M. and Albert,P.R.
Journal J. Cell. Physiol. 225 (3), 865-874 (2010)
Title Guanine nucleotide-binding regulatory proteins in retinal pigment epithelial cells .
Author Jiang,M., Pandey,S., Tran,V.T. and Fong,H.K.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (9), 3907-3911 (1991)
Title Distinct guanine nucleotide binding and release properties of the three Gi proteins .
Author Carty,D.J., Padrell,E., Codina,J., Birnbaumer,L., Hildebrandt,J.D. and Iyengar,R.
Journal J. Biol. Chem. 265 (11), 6268-6273 (1990)
Title Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs .
Author Itoh,H., Toyama,R., Kozasa,T., Tsukamoto,T., Matsuoka,M. and Kaziro,Y.
Journal J. Biol. Chem. 263 (14), 6656-6664 (1988)
Title Alpha i-3 cDNA encodes the alpha subunit of Gk, the stimulatory G protein of receptor-regulated K+ channels .
Author Codina,J., Olate,J., Abramowitz,J., Mattera,R., Cook,R.G. and Birnbaumer,L.
Journal J. Biol. Chem. 263 (14), 6746-6750 (1988)
Title The human genome encodes at least three non-allellic G proteins with alpha i-type subunits .
Author Suki,W.N., Abramowitz,J., Mattera,R., Codina,J. and Birnbaumer,L.
Journal FEBS Lett. 220 (1), 187-192 (1987)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.