• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens sodium channel, voltage-gated, type X, alpha subunit (SCN10A), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_006514 Homo sapiens sodium channel, voltage-gated, type X, alpha subunit (SCN10A), mRNA. GenEZ ORF Cloning On-demand $2699.00 30

*Business Day

Related Services

RefSeq Version NM_006514.2, 110835709
Length 5874 bp
Structure linear
Update Date 18-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens sodium channel, voltage-gated, type X, alpha subunit (SCN10A), mRNA.
Product sodium channel protein type 10 subunit alpha
Comment

Summary: The protein encoded by this gene is a tetrodotoxin-resistant voltage-gated sodium channel alpha subunit. The properties of the channel formed by the encoded transmembrane protein can be altered by interaction with different beta subunits. This protein may be involved in the onset of pain associated with peripheral neuropathy. [provided by RefSeq, Dec 2011].

RefSeq NP_006505.2
CDS 1..5871
Misc Feature(1)373..1200
Misc Feature(2)373..1200
Misc Feature(3)376..447
Misc Feature(4)463..522
Misc Feature(5)466..1188
Misc Feature(6)562..618
Misc Feature(7)637..696
Misc Feature(8)745..816
Misc Feature(9)1120..1197
Misc Feature(10)1342..1848
Misc Feature(11)1975..2673
Misc Feature(12)1978..2052
Misc Feature(13)2086..2157
Misc Feature(14)2095..2610
Misc Feature(15)2182..2241
Misc Feature(16)2260..2319
Misc Feature(17)2368..2430
Misc Feature(18)2593..2670
Misc Feature(19)2710..3486
Misc Feature(20)3439..4257
Misc Feature(21)3442..3513
Misc Feature(22)3553..3630
Misc Feature(23)3562..4251
Misc Feature(24)3649..3714
Misc Feature(25)3727..3792
Misc Feature(26)3850..3933
Misc Feature(27)4174..4254
Misc Feature(28)4411..5169
Misc Feature(29)4414..4485
Misc Feature(30)4519..4590
Misc Feature(31)4531..5163
Misc Feature(32)4609..4680
Misc Feature(33)4717..4782
Misc Feature(34)4828..4896
Misc Feature(35)5092..5166
Exon (1)271..389
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (2)390..470
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (3)471..599
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (4)600..691
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (5)692..883
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (6)884..950
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (7)951..1092
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (8)1093..1290
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (9)1291..1461
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (10)1462..1755
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (11)1756..1867
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (12)1868..2106
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (13)2107..2280
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (14)2281..2640
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (15)2641..3087
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (16)3088..3228
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (17)3229..3352
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (18)3353..3507
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (19)3508..3681
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (20)3682..3804
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (21)3805..4089
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (22)4090..4143
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (23)4144..4281
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (24)4282..4386
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (25)4387..4657
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Exon (26)4658..5874
Gene:SCN10A
Gene Synonym:hPN3; Nav1.8; PN3; SNS
Translation MEFPIGSLETNNFRRFTPESLVEIEKQIAAKQGTKKAREKHREQKDQEEKPRPQLDLKAC NQLPKFYGELPAELIGEPLEDLDPFYSTHRTFMVLNKGRTISRFSATRALWLFSPFNLIR RTAIKVSVHSWFSLFITVTILVNCVCMTRTDLPEKIEYVFTVIYTFEALIKILARGFCLN EFTYLRDPWNWLDFSVITLAYVGTAIDLRGISGLRTFRVLRALKTVSVIPGLKVIVGALI HSVKKLADVTILTIFCLSVFALVGLQLFKGNLKNKCVKNDMAVNETTNYSSHRKPDIYIN KRGTSDPLLCGNGSDSGHCPDGYICLKTSDNPDFNYTSFDSFAWAFLSLFRLMTQDSWER LYQQTLRTSGKIYMIFFVLVIFLGSFYLVNLILAVVTMAYEEQNQATTDEIEAKEKKFQE ALEMLRKEQEVLAALGIDTTSLHSHNGSPLTSKNASERRHRIKPRVSEGSTEDNKSPRSD PYNQRRMSFLGLASGKRRASHGSVFHFRSPGRDISLPEGVTDDGVFPGDHESHRGSLLLG GGAGQQGPLPRSPLPQPSNPDSRHGEDEHQPPPTSELAPGAVDVSAFDAGQKKTFLSAEY LDEPFRAQRAMSVVSIITSVLEELEESEQKCPPCLTSLSQKYLIWDCCPMWVKLKTILFG LVTDPFAELTITLCIVVNTIFMAMEHHGMSPTFEAMLQIGNIVFTIFFTAEMVFKIIAFD PYYYFQKKWNIFDCIIVTVSLLELGVAKKGSLSVLRSFRLLRVFKLAKSWPTLNTLIKII GNSVGALGNLTIILAIIVFVFALVGKQLLGENYRNNRKNISAPHEDWPRWHMHDFFHSFL IVFRILCGEWIENMWACMEVGQKSICLILFLTVMVLGNLVVLNLFIALLLNSFSADNLTA PEDDGEVNNLQVALARIQVFGHRTKQALCSFFSRSCPFPQPKAEPELVVKLPLSSSKAEN HIAANTARGSSGGLQAPRGPRDEHSDFIANPTVWVSVPIAEGESDLDDLEDDGGEDAQSF QQEVIPKGQQEQLQQVERCGDHLTPRSPGTGTSSEDLAPSLGETWKDESVPQVPAEGVDD TSSSEGSTVDCLDPEEILRKIPELADDLEEPDDCFTEGCIRHCPCCKLDTTKSPWDVGWQ VRKTCYRIVEHSWFESFIIFMILLSSGSLAFEDYYLDQKPTVKALLEYTDRVFTFIFVFE MLLKWVAYGFKKYFTNAWCWLDFLIVNISLISLTAKILEYSEVAPIKALRTLRALRPLRA LSRFEGMRVVVDALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFWRCINYTDGEFSL VPLSIVNNKSDCKIQNSTGSFFWVNVKVNFDNVAMGYLALLQVATFKGWMDIMYAAVDSR EVNMQPKWEDNVYMYLYFVIFIIFGGFFTLNLFVGVIIDNFNQQKKKLGGQDIFMTEEQK KYYNAMKKLGSKKPQKPIPRPLNKFQGFVFDIVTRQAFDITIMVLICLNMITMMVETDDQ SEEKTKILGKINQFFVAVFTGECVMKMFALRQYYFTNGWNVFDFIVVVLSIASLIFSAIL KSLQSYFSPTLFRVIRLARIGRILRLIRAAKGIRTLLFALMMSLPALFNIGLLLFLVMFI YSIFGMSSFPHVRWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCDP NLPNSNGTRGDCGSPAVGIIFFTTYIIISFLIMVNMYIAVILENFNVATEESTEPLSEDD FDMFYETWEKFDPEATQFITFSALSDFADTLSGPLRIPKPNRNILIQMDLPLVPGDKIHC LDILFAFTKNVLGESGELDSLKANMEEKFMATNLSKSSYEPIATTLRWKQEDISATVIQK AYRSYVLHRSMALSNTPCVPRAEEEAASLPDEGFVAFTANENCVLPDKSETASATSFPPS YESVTRGLSDRVNMRTSSSIQNEDEATSMELIAPGP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(33)-dbSNP:
complement(33)-g, cdbSNP:201415200
complement(39)-g, adbSNP:181048561
complement(41)-c, adbSNP:141207048
complement(45)-g, adbSNP:34314583
complement(53)-g, adbSNP:190176472
complement(55)-t, cdbSNP:141810266
complement(87)-g, adbSNP:148392780
complement(132)-t, cdbSNP:138739418
complement(179)-t, cdbSNP:145900411
complement(195)-t, cdbSNP:138298994
complement(196)-g, adbSNP:199812598
complement(231)-t, cdbSNP:200249016
complement(251)-g, adbSNP:140609990
complement(255)-g, adbSNP:150781655
complement(258)-g, adbSNP:201680315
complement(268)-g, adbSNP:144270136
complement(281)-dbSNP:
complement(281)-c, adbSNP:202143516
complement(308)-t, cdbSNP:199973777
complement(323)-t, cdbSNP:141278729
complement(365)-g, adbSNP:142884499
complement(410)-dbSNP:
complement(410)-g, adbSNP:148663098
complement(411)-t, cdbSNP:139793167
complement(425)-c, adbSNP:142689389
complement(446)-t, cdbSNP:201706560
complement(451)-g, cdbSNP:149491608
complement(472)-dbSNP:
complement(472)-c, adbSNP:202192818
complement(542)-t, gdbSNP:142203439
complement(549)-t, cdbSNP:141703064
complement(618)-dbSNP:
complement(618)-t, cdbSNP:74717885
complement(625)-g, adbSNP:138262927
complement(648)-t, gdbSNP:150977149
complement(682)-t, cdbSNP:141368548
complement(688)-g, cdbSNP:147844607
complement(694)-dbSNP:
complement(694)-g, adbSNP:200583405
complement(724)-t, adbSNP:140288103
complement(727)-t, cdbSNP:140292361
complement(801)-g, adbSNP:149892218
complement(829)-t, cdbSNP:142124216
complement(853)-t, cdbSNP:146151670
complement(857)-g, adbSNP:147150438
complement(890)-dbSNP:
complement(890)-g, adbSNP:138174025
complement(905)-t, cdbSNP:201955990
complement(921)-g, adbSNP:192946276
complement(955)-dbSNP:
complement(955)-t, adbSNP:199715855
complement(969)-g, adbSNP:143668889
complement(1029)-g, adbSNP:138792429
complement(1118)-dbSNP:
complement(1118)-t, cdbSNP:147835034
complement(1138)-t, cdbSNP:142276689
complement(1141)-t, cdbSNP:150923753
complement(1157)-c, adbSNP:78555408
complement(1163)-g, adbSNP:199734710
complement(1186)-t, cdbSNP:191389107
complement(1225)-t, cdbSNP:201174558
complement(1233)-t, adbSNP:144482572
complement(1247)-t, cdbSNP:140123977
complement(1266)-g, adbSNP:143438557
complement(1277)-t, cdbSNP:143033805
complement(1284)-t, cdbSNP:62244070
complement(1315)-dbSNP:
complement(1315)-t, cdbSNP:146536985
complement(1389)-c, adbSNP:201575317
complement(1417)-g, cdbSNP:143920053
complement(1430)-g, adbSNP:142235256
complement(1444)-g, adbSNP:150383700
complement(1453)-g, adbSNP:151153639
complement(1458..1459)-, cdbSNP:35523546
complement(1476)-dbSNP:
complement(1476)-g, adbSNP:7617919
complement(1477)-t, cdbSNP:146596599
complement(1522)-g, adbSNP:112774699
complement(1525)-g, adbSNP:7630989
complement(1534)-g, adbSNP:200714519
complement(1535)-t, cdbSNP:200889952
complement(1601)-t, cdbSNP:147246725
complement(1661)-g, adbSNP:138404783
complement(1689)-t, cdbSNP:141723935
complement(1712)-g, adbSNP:148046286
complement(1713)-t, cdbSNP:148905110
complement(1761)-dbSNP:
complement(1761)-g, adbSNP:199645904
complement(1768)-t, cdbSNP:35332705
complement(1819)-c, adbSNP:139355449
complement(1858)-t, cdbSNP:151303346
complement(1878)-dbSNP:
complement(1878)-c, adbSNP:139209095
complement(1908)-g, adbSNP:147235762
complement(1949)-t, adbSNP:201698323
complement(1969)-t, cdbSNP:145340027
complement(2105)-c, adbSNP:147482520
complement(2130)-dbSNP:
complement(2130)-t, adbSNP:150772114
complement(2157)-g, adbSNP:199787775
complement(2170)-c, adbSNP:138751097
complement(2197)-t, cdbSNP:144913600
complement(2221)-g, cdbSNP:137906740
complement(2222)-c, adbSNP:201342036
complement(2282)-dbSNP:
complement(2282)-g, adbSNP:139988577
complement(2321)-t, cdbSNP:200304117
complement(2324)-g, adbSNP:150501065
complement(2341)-t, cdbSNP:148851890
complement(2366)-t, cdbSNP:111788645
complement(2367)-t, gdbSNP:149828833
complement(2428)-c, adbSNP:145712124
complement(2431)-t, cdbSNP:77049337
complement(2441)-t, cdbSNP:139861061
complement(2443)-t, cdbSNP:148748248
complement(2450)-t, cdbSNP:201068959
complement(2464)-t, cdbSNP:144304164
complement(2475)-t, gdbSNP:146028829
complement(2476)-t, cdbSNP:199535863
complement(2498)-t, adbSNP:137858823
complement(2530)-g, adbSNP:140158387
complement(2625)-c, adbSNP:143092568
complement(2635)-t, gdbSNP:201330370
complement(2650)-dbSNP:
complement(2650)-g, cdbSNP:191056911
complement(2658)-g, adbSNP:148963942
complement(2703)-t, cdbSNP:142531478
complement(2737)-t, cdbSNP:201054824
complement(2757)-t, gdbSNP:200993949
complement(2814)-g, adbSNP:200870389
complement(2816)-g, adbSNP:202174472
complement(2832)-c, adbSNP:141861200
complement(2834)-g, adbSNP:11707331
complement(2842)-g, cdbSNP:145694222
complement(2850)-t, cdbSNP:7374804
complement(2884)-t, cdbSNP:57326399
complement(2930)-g, adbSNP:200163378
complement(2937)-g, adbSNP:59468016
complement(2972)-g, adbSNP:138413438
complement(2973)-t, cdbSNP:201397469
complement(2994)-g, adbSNP:200267333
complement(3007)-t, cdbSNP:150111722
complement(3010)-c, adbSNP:186031413
complement(3020)-t, cdbSNP:199641736
complement(3047)-t, adbSNP:200601591
complement(3070)-t, cdbSNP:201106879
complement(3130)-dbSNP:
complement(3130)-t, cdbSNP:147093541
complement(3133)-t, gdbSNP:73062575
complement(3174)-g, adbSNP:149136109
complement(3192)-t, cdbSNP:6791171
complement(3218)-g, adbSNP:6795970
complement(3255)-dbSNP:
complement(3255)-t, cdbSNP:143610297
complement(3264)-t, cdbSNP:139332101
complement(3275)-g, adbSNP:12632942
complement(3291)-g, cdbSNP:148041371
complement(3328)-g, cdbSNP:201871493
complement(3361)-dbSNP:
complement(3361)-t, gdbSNP:146965005
complement(3362)-t, cdbSNP:201588811
complement(3371)-g, adbSNP:143208505
complement(3379)-t, adbSNP:150260693
complement(3393)-g, cdbSNP:6771157
complement(3417)-g, cdbSNP:143744796
complement(3421)-t, cdbSNP:112412281
complement(3425)-t, cdbSNP:200584416
complement(3442)-t, adbSNP:201827217
complement(3466)-t, cdbSNP:199542685
complement(3474)-g, cdbSNP:145568435
complement(3482)-g, adbSNP:200713724
complement(3542)-dbSNP:
complement(3542)-g, adbSNP:150773437
complement(3555)-c, adbSNP:201025253
complement(3556)-t, gdbSNP:192493052
complement(3598)-t, cdbSNP:202199966
complement(3670)-g, adbSNP:200597401
complement(3674)-g, adbSNP:139638446
complement(3692)-dbSNP:
complement(3692)-g, adbSNP:147130891
complement(3705)-t, cdbSNP:147376215
complement(3711)-t, adbSNP:148339462
complement(3748)-g, adbSNP:202134330
complement(3753)-t, gdbSNP:144350950
complement(3757)-t, gdbSNP:145909172
complement(3796)-t, cdbSNP:199892190
complement(3803)-t, cdbSNP:138832868
complement(3838)-dbSNP:
complement(3838)-t, adbSNP:200324539
complement(3852)-g, adbSNP:147549873
complement(3859)-t, cdbSNP:145032037
complement(3910)-c, adbSNP:142173735
complement(3943)-t, cdbSNP:147640811
complement(3972)-t, cdbSNP:149883899
complement(3990)-c, adbSNP:149685953
complement(4009)-t, adbSNP:11711062
complement(4053)-g, adbSNP:139073590
complement(4069)-t, adbSNP:199703203
complement(4092)-dbSNP:
complement(4092)-t, gdbSNP:139436496
complement(4113)-g, cdbSNP:138786127
complement(4139)-t, cdbSNP:149155352
complement(4179)-dbSNP:
complement(4179)-g, adbSNP:150442007
complement(4192)-g, adbSNP:201234101
complement(4208)-g, adbSNP:140825889
complement(4217)-g, cdbSNP:201280426
complement(4323)-dbSNP:
complement(4323)-t, cdbSNP:6790627
complement(4348)-t, cdbSNP:202131976
complement(4378)-g, adbSNP:148619598
complement(4396)-dbSNP:
complement(4396)-g, adbSNP:199931920
complement(4416)-g, adbSNP:144944369
complement(4491)-c, adbSNP:201148315
complement(4514)-g, adbSNP:184521520
complement(4515)-t, cdbSNP:191624001
complement(4525)-t, cdbSNP:187118004
complement(4551)-g, adbSNP:139655085
complement(4552)-t, cdbSNP:202040659
complement(4568)-t, cdbSNP:142217269
complement(4584)-g, adbSNP:141828577
complement(4623)-t, cdbSNP:143688921
complement(4656)-t, cdbSNP:151182542
complement(4694)-dbSNP:
complement(4694)-t, cdbSNP:200063383
complement(4710)-t, cdbSNP:78425180
complement(4723)-t, cdbSNP:140694303
complement(4762)-t, gdbSNP:142537392
complement(4798)-g, adbSNP:201461161
complement(4830)-g, adbSNP:139221219
complement(4866)-g, adbSNP:6599242
complement(4872)-g, adbSNP:149642957
complement(4875)-t, adbSNP:139229524
complement(4890..4891)-, gdbSNP:71635874
complement(4893)-g, adbSNP:139127319
complement(4917)-g, adbSNP:142804903
complement(4956)-t, cdbSNP:148256707
complement(4958)-c, adbSNP:137874410
complement(4959)-g, adbSNP:150301002
complement(4976)-g, adbSNP:200761212
complement(4977)-t, cdbSNP:143317913
complement(4984)-t, cdbSNP:151090729
complement(5022)-t, cdbSNP:112795612
complement(5026)-g, cdbSNP:147627083
complement(5047)-g, adbSNP:146999807
complement(5078)-t, cdbSNP:145756648
complement(5089)-t, cdbSNP:77804526
complement(5093)-c, adbSNP:201985536
complement(5101)-g, adbSNP:199541482
complement(5136)-g, adbSNP:144598009
complement(5137)-t, cdbSNP:6599241
complement(5199)-g, adbSNP:113721356
complement(5200)-t, cdbSNP:200645452
complement(5217)-g, adbSNP:116353929
complement(5245)-t, cdbSNP:141767849
complement(5249)-t, cdbSNP:145589241
complement(5256)-g, adbSNP:138532656
complement(5295)-t, cdbSNP:145313578
complement(5358)-g, adbSNP:188413410
complement(5370)-c, adbSNP:140566252
complement(5382)-g, adbSNP:184021595
complement(5436)-t, cdbSNP:201753955
complement(5445)-g, adbSNP:111535651
complement(5496)-g, adbSNP:112374164
complement(5523)-t, cdbSNP:147245558
complement(5539)-g, adbSNP:199503439
complement(5540)-t, cdbSNP:148537653
complement(5548)-g, adbSNP:149504103
complement(5576)-t, gdbSNP:146269698
complement(5588)-t, cdbSNP:191869263
complement(5603)-t, gdbSNP:115463830
complement(5605)-g, adbSNP:141648641
complement(5628)-g, cdbSNP:147660344
complement(5630)-g, adbSNP:143523403
complement(5656)-t, cdbSNP:148979438
complement(5657)-g, adbSNP:142653846
complement(5757)-t, cdbSNP:145340685
complement(5780)-t, cdbSNP:201024779
Gene SymbolSCN10A
Gene SynonymhPN3; Nav1.8; PN3; SNS
Chromosome3
Locus Map3p22.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006514 Homo sapiens sodium channel, voltage-gated, type X, alpha subunit (SCN10A), mRNA. On-demand $2699.00 30
Title Gain-of-function Nav1.8 mutations in painful neuropathy .
Author Faber,C.G., Lauria,G., Merkies,I.S., Cheng,X., Han,C., Ahn,H.S., Persson,A.K., Hoeijmakers,J.G., Gerrits,M.M., Pierro,T., Lombardi,R., Kapetis,D., Dib-Hajj,S.D. and Waxman,S.G.
Journal Proc. Natl. Acad. Sci. U.S.A. 109 (47), 19444-19449 (2012)
Title Localisation of SCN10A gene product Na(v)1.8 and novel pain-related ion channels in human heart .
Author Facer,P., Punjabi,P.P., Abrari,A., Kaba,R.A., Severs,N.J., Chambers,J., Kooner,J.S. and Anand,P.
Journal Int Heart J 52 (3), 146-152 (2011)
Title Common variants in 22 loci are associated with QRS duration and cardiac ventricular conduction .
Author Sotoodehnia,N., Isaacs,A., de Bakker,P.I., Dorr,M., Newton-Cheh,C., Nolte,I.M., van der Harst,P., Muller,M., Eijgelsheim,M., Alonso,A., Hicks,A.A., Padmanabhan,S., Hayward,C., Smith,A.V., Polasek,O., Giovannone,S., Fu,J., Magnani,J.W., Marciante,K.D., Pfeufer,A., Gharib,S.A., Teumer,A., Li,M., Bis,J.C., Rivadeneira,F., Aspelund,T., Kottgen,A., Johnson,T., Rice,K., Sie,M.P., Wang,Y.A., Klopp,N., Fuchsberger,C., Wild,S.H., Mateo Leach,I., Estrada,K., Volker,U., Wright,A.F., Asselbergs,F.W., Qu,J., Chakravarti,A., Sinner,M.F., Kors,J.A., Petersmann,A., Harris,T.B., Soliman,E.Z., Munroe,P.B., Psaty,B.M., Oostra,B.A., Cupples,L.A., Perz,S., de Boer,R.A., Uitterlinden,A.G., Volzke,H., Spector,T.D., Liu,F.Y., Boerwinkle,E., Dominiczak,A.F., Rotter,J.I., van Herpen,G., Levy,D., Wichmann,H.E., van Gilst,W.H., Witteman,J.C., Kroemer,H.K., Kao,W.H., Heckbert,S.R., Meitinger,T., Hofman,A., Campbell,H., Folsom,A.R., van Veldhuisen,D.J., Schwienbacher,C., O'Donnell,C.J., Volpato,C.B., Caulfield,M.J., Connell,J.M., Launer,L., Lu,X., Franke,L., Fehrmann,R.S., te Meerman,G., Groen,H.J., Weersma,R.K., van den Berg,L.H., Wijmenga,C., Ophoff,R.A., Navis,G., Rudan,I., Snieder,H., Wilson,J.F., Pramstaller,P.P., Siscovick,D.S., Wang,T.J., Gudnason,V., van Duijn,C.M., Felix,S.B., Fishman,G.I., Jamshidi,Y., Stricker,B.H., Samani,N.J., Kaab,S. and Arking,D.E.
Journal Nat. Genet. 42 (12), 1068-1076 (2010)
Title Identification of genomic predictors of atrioventricular conduction: using electronic medical records as a tool for genome science .
Author Denny,J.C., Ritchie,M.D., Crawford,D.C., Schildcrout,J.S., Ramirez,A.H., Pulley,J.M., Basford,M.A., Masys,D.R., Haines,J.L. and Roden,D.M.
Journal Circulation 122 (20), 2016-2021 (2010)
Title Transmembrane segments prevent surface expression of sodium channel Nav1.8 and promote calnexin-dependent channel degradation .
Author Li,Q., Su,Y.Y., Wang,H., Li,L., Wang,Q. and Bao,L.
Journal J. Biol. Chem. 285 (43), 32977-32987 (2010)
Title A high-capacity membrane potential FRET-based assay for NaV1.8 channels .
Author Liu,C.J., Priest,B.T., Bugianesi,R.M., Dulski,P.M., Felix,J.P., Dick,I.E., Brochu,R.M., Knaus,H.G., Middleton,R.E., Kaczorowski,G.J., Slaughter,R.S., Garcia,M.L. and Kohler,M.G.
Journal Assay Drug Dev Technol 4 (1), 37-48 (2006)
Title International Union of Pharmacology. XLVII. Nomenclature and structure-function relationships of voltage-gated sodium channels .
Author Catterall,W.A., Goldin,A.L. and Waxman,S.G.
Journal Pharmacol. Rev. 57 (4), 397-409 (2005)
Title Sensory neuron proteins interact with the intracellular domains of sodium channel NaV1.8 .
Author Malik-Hall,M., Poon,W.Y., Baker,M.D., Wood,J.N. and Okuse,K.
Journal Brain Res. Mol. Brain Res. 110 (2), 298-304 (2003)
Title Evolution and diversity of mammalian sodium channel genes .
Author Plummer,N.W. and Meisler,M.H.
Journal Genomics 57 (2), 323-331 (1999)
Title A tetrodotoxin-resistant voltage-gated sodium channel from human dorsal root ganglia, hPN3/SCN10A .
Author Rabert,D.K., Koch,B.D., Ilnicka,M., Obernolte,R.A., Naylor,S.L., Herman,R.C., Eglen,R.M., Hunter,J.C. and Sangameswaran,L.
Journal Pain 78 (2), 107-114 (1998)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.