• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens sodium channel, voltage-gated, type X, alpha subunit (SCN10A), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu27900 Homo sapiens sodium channel, voltage-gated, type X, alpha subunit (SCN10A), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $2699.00 30
OHu27900C Homo sapiens sodium channel, voltage-gated, type X, alpha subunit (SCN10A), transcript variant 1, mRNA. Customized vector On-demand $2699.00 30

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_006514.2, 110835709
Length 5871 bp
Structure linear
Update Date 07-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens sodium channel, voltage-gated, type X, alpha subunit (SCN10A), transcript variant 1, mRNA.
Product sodium channel protein type 10 subunit alpha isoform 1
Comment

Summary: The protein encoded by this gene is a tetrodotoxin-resistant voltage-gated sodium channel alpha subunit. The properties of the channel formed by the encoded transmembrane protein can be altered by interaction with different beta subunits. This protein may be involved in the onset of pain associated with peripheral neuropathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014].


Transcript Variant: This variant (1) encodes the longest isoform (1).

RefSeq NP_006505.2
CDS 1..5871
Misc Feature(1)373..1200
Misc Feature(2)373..1200
Misc Feature(3)376..447
Misc Feature(4)463..522
Misc Feature(5)466..1188
Misc Feature(6)562..618
Misc Feature(7)637..696
Misc Feature(8)745..816
Misc Feature(9)1120..1197
Misc Feature(10)1342..>1599
Misc Feature(11)1975..2673
Misc Feature(12)1978..2052
Misc Feature(13)2086..2157
Misc Feature(14)2095..2667
Misc Feature(15)2182..2241
Misc Feature(16)2260..2319
Misc Feature(17)2368..2430
Misc Feature(18)2593..2670
Misc Feature(19)2710..3486
Misc Feature(20)3439..4257
Misc Feature(21)3442..3513
Misc Feature(22)3553..3630
Misc Feature(23)3562..4251
Misc Feature(24)3649..3714
Misc Feature(25)3727..3792
Misc Feature(26)3850..3933
Misc Feature(27)4174..4254
Misc Feature(28)4255..4413
Misc Feature(29)4297..4308
Misc Feature(30)4351..4353
Misc Feature(31)4411..5169
Misc Feature(32)4414..4485
Misc Feature(33)4519..4590
Misc Feature(34)4531..5034
Misc Feature(35)4609..4680
Misc Feature(36)4717..4782
Misc Feature(37)4828..4896
Misc Feature(38)5092..5166
Exon (1)271..389
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (2)390..470
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (3)471..599
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (4)600..691
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (5)692..883
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (6)884..950
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (7)951..1092
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (8)1093..1290
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (9)1291..1461
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (10)1462..1755
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (11)1756..1867
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (12)1868..2106
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (13)2107..2280
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (14)2281..2640
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (15)2641..3087
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (16)3088..3228
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (17)3229..3352
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (18)3353..3507
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (19)3508..3681
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (20)3682..3804
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (21)3805..4089
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (22)4090..4143
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (23)4144..4281
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (24)4282..4386
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (25)4387..4657
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Exon (26)4658..5874
Gene:SCN10A
Gene Synonym:FEPS2; hPN3; Nav1.8; PN3; SNS
Translation MEFPIGSLETNNFRRFTPESLVEIEKQIAAKQGTKKAREKHREQKDQEEKPRPQLDLKAC NQLPKFYGELPAELIGEPLEDLDPFYSTHRTFMVLNKGRTISRFSATRALWLFSPFNLIR RTAIKVSVHSWFSLFITVTILVNCVCMTRTDLPEKIEYVFTVIYTFEALIKILARGFCLN EFTYLRDPWNWLDFSVITLAYVGTAIDLRGISGLRTFRVLRALKTVSVIPGLKVIVGALI HSVKKLADVTILTIFCLSVFALVGLQLFKGNLKNKCVKNDMAVNETTNYSSHRKPDIYIN KRGTSDPLLCGNGSDSGHCPDGYICLKTSDNPDFNYTSFDSFAWAFLSLFRLMTQDSWER LYQQTLRTSGKIYMIFFVLVIFLGSFYLVNLILAVVTMAYEEQNQATTDEIEAKEKKFQE ALEMLRKEQEVLAALGIDTTSLHSHNGSPLTSKNASERRHRIKPRVSEGSTEDNKSPRSD PYNQRRMSFLGLASGKRRASHGSVFHFRSPGRDISLPEGVTDDGVFPGDHESHRGSLLLG GGAGQQGPLPRSPLPQPSNPDSRHGEDEHQPPPTSELAPGAVDVSAFDAGQKKTFLSAEY LDEPFRAQRAMSVVSIITSVLEELEESEQKCPPCLTSLSQKYLIWDCCPMWVKLKTILFG LVTDPFAELTITLCIVVNTIFMAMEHHGMSPTFEAMLQIGNIVFTIFFTAEMVFKIIAFD PYYYFQKKWNIFDCIIVTVSLLELGVAKKGSLSVLRSFRLLRVFKLAKSWPTLNTLIKII GNSVGALGNLTIILAIIVFVFALVGKQLLGENYRNNRKNISAPHEDWPRWHMHDFFHSFL IVFRILCGEWIENMWACMEVGQKSICLILFLTVMVLGNLVVLNLFIALLLNSFSADNLTA PEDDGEVNNLQVALARIQVFGHRTKQALCSFFSRSCPFPQPKAEPELVVKLPLSSSKAEN HIAANTARGSSGGLQAPRGPRDEHSDFIANPTVWVSVPIAEGESDLDDLEDDGGEDAQSF QQEVIPKGQQEQLQQVERCGDHLTPRSPGTGTSSEDLAPSLGETWKDESVPQVPAEGVDD TSSSEGSTVDCLDPEEILRKIPELADDLEEPDDCFTEGCIRHCPCCKLDTTKSPWDVGWQ VRKTCYRIVEHSWFESFIIFMILLSSGSLAFEDYYLDQKPTVKALLEYTDRVFTFIFVFE MLLKWVAYGFKKYFTNAWCWLDFLIVNISLISLTAKILEYSEVAPIKALRTLRALRPLRA LSRFEGMRVVVDALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFWRCINYTDGEFSL VPLSIVNNKSDCKIQNSTGSFFWVNVKVNFDNVAMGYLALLQVATFKGWMDIMYAAVDSR EVNMQPKWEDNVYMYLYFVIFIIFGGFFTLNLFVGVIIDNFNQQKKKLGGQDIFMTEEQK KYYNAMKKLGSKKPQKPIPRPLNKFQGFVFDIVTRQAFDITIMVLICLNMITMMVETDDQ SEEKTKILGKINQFFVAVFTGECVMKMFALRQYYFTNGWNVFDFIVVVLSIASLIFSAIL KSLQSYFSPTLFRVIRLARIGRILRLIRAAKGIRTLLFALMMSLPALFNIGLLLFLVMFI YSIFGMSSFPHVRWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCDP NLPNSNGTRGDCGSPAVGIIFFTTYIIISFLIMVNMYIAVILENFNVATEESTEPLSEDD FDMFYETWEKFDPEATQFITFSALSDFADTLSGPLRIPKPNRNILIQMDLPLVPGDKIHC LDILFAFTKNVLGESGELDSLKANMEEKFMATNLSKSSYEPIATTLRWKQEDISATVIQK AYRSYVLHRSMALSNTPCVPRAEEEAASLPDEGFVAFTANENCVLPDKSETASATSFPPS YESVTRGLSDRVNMRTSSSIQNEDEATSMELIAPGP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(33)-dbSNP:
complement(33)-g, cdbSNP:201415200
complement(39)-g, adbSNP:181048561
complement(41)-c, adbSNP:141207048
complement(45)-g, adbSNP:34314583
complement(53)-g, adbSNP:190176472
complement(54)-t, cdbSNP:371527903
complement(55)-t, cdbSNP:141810266
complement(80)-t, cdbSNP:367571651
complement(87)-g, adbSNP:148392780
complement(132)-t, cdbSNP:138739418
complement(144)-t, gdbSNP:368338265
complement(151)-g, cdbSNP:368312678
complement(179)-t, cdbSNP:145900411
complement(195)-t, cdbSNP:138298994
complement(196)-g, adbSNP:199812598
complement(231)-t, cdbSNP:200249016
complement(251)-g, adbSNP:140609990
complement(255)-g, adbSNP:150781655
complement(258)-g, adbSNP:201680315
complement(268)-g, adbSNP:144270136
complement(281)-dbSNP:
complement(281)-c, adbSNP:202143516
complement(308)-t, cdbSNP:199973777
complement(323)-t, cdbSNP:141278729
complement(365)-g, adbSNP:142884499
complement(366)-t, cdbSNP:369562725
complement(390)-dbSNP:
complement(390)-t, cdbSNP:375425965
complement(406)-t, cdbSNP:372138097
complement(410)-g, adbSNP:148663098
complement(411)-t, cdbSNP:139793167
complement(434)-g, adbSNP:367751260
complement(446)-t, cdbSNP:201706560
complement(451)-g, cdbSNP:149491608
complement(472)-dbSNP:
complement(472)-c, adbSNP:202192818
complement(533)-c, adbSNP:373947111
complement(539)-t, cdbSNP:371221408
complement(542)-t, gdbSNP:142203439
complement(549)-t, cdbSNP:141703064
complement(585)-g, adbSNP:368232949
complement(618)-dbSNP:
complement(618)-t, cdbSNP:74717885
complement(621)-t, adbSNP:377716847
complement(625)-g, adbSNP:138262927
complement(648)-t, gdbSNP:150977149
complement(682)-t, cdbSNP:141368548
complement(686)-g, adbSNP:370200847
complement(688)-g, cdbSNP:147844607
complement(694)-dbSNP:
complement(694)-g, adbSNP:200583405
complement(715)-g, adbSNP:369923291
complement(724)-t, adbSNP:140288103
complement(727)-t, cdbSNP:140292361
complement(801)-g, adbSNP:149892218
complement(812)-t, cdbSNP:375401531
complement(829)-t, cdbSNP:142124216
complement(853)-t, cdbSNP:146151670
complement(857)-g, adbSNP:147150438
complement(883)-g, adbSNP:371909817
complement(902)-dbSNP:
complement(902)-t, gdbSNP:370912250
complement(905)-t, cdbSNP:201955990
complement(921)-g, adbSNP:192946276
complement(955)-dbSNP:
complement(955)-t, adbSNP:199715855
complement(965)-t, cdbSNP:373391820
complement(969)-g, adbSNP:143668889
complement(1029)-g, adbSNP:138792429
complement(1051)-g, adbSNP:370603046
complement(1080)-g, adbSNP:375904859
complement(1110)-dbSNP:
complement(1110)-t, c, adbSNP:267599808
complement(1118)-t, cdbSNP:147835034
complement(1138)-t, cdbSNP:142276689
complement(1141)-t, cdbSNP:150923753
complement(1157)-c, adbSNP:78555408
complement(1163)-g, adbSNP:199734710
complement(1186)-t, cdbSNP:191389107
complement(1196)-g, adbSNP:371834396
complement(1225)-t, cdbSNP:201174558
complement(1233)-t, adbSNP:144482572
complement(1247)-t, cdbSNP:140123977
complement(1254)-g, adbSNP:267599807
complement(1266)-g, adbSNP:143438557
complement(1277)-t, cdbSNP:143033805
complement(1284)-t, cdbSNP:62244070
complement(1315)-dbSNP:
complement(1315)-t, cdbSNP:146536985
complement(1389)-c, adbSNP:201575317
complement(1399)-g, adbSNP:373895507
complement(1417)-g, cdbSNP:143920053
complement(1430)-g, adbSNP:142235256
complement(1444)-g, adbSNP:150383700
complement(1453)-g, adbSNP:151153639
complement(1458..1459)-, cdbSNP:35523546
complement(1476)-dbSNP:
complement(1476)-g, adbSNP:7617919
complement(1477)-t, cdbSNP:146596599
complement(1489)-g, adbSNP:370009920
complement(1492)-g, adbSNP:377467259
complement(1493)-t, cdbSNP:372716583
complement(1522)-g, adbSNP:112774699
complement(1523)-t, cdbSNP:368776882
complement(1525)-g, adbSNP:7630989
complement(1534)-g, adbSNP:200714519
complement(1535)-t, cdbSNP:200889952
complement(1544)-g, adbSNP:267599806
complement(1556)-c, adbSNP:369629253
complement(1601)-t, cdbSNP:147246725
complement(1661)-g, adbSNP:138404783
complement(1689)-t, cdbSNP:141723935
complement(1712)-g, adbSNP:148046286
complement(1713)-t, cdbSNP:148905110
complement(1761)-dbSNP:
complement(1761)-g, adbSNP:199645904
complement(1768)-t, cdbSNP:35332705
complement(1803)-t, cdbSNP:371341956
complement(1817)-g, cdbSNP:367548480
complement(1819)-c, adbSNP:139355449
complement(1857)-g, adbSNP:374060366
complement(1858)-t, cdbSNP:151303346
complement(1872)-dbSNP:
complement(1872)-g, adbSNP:375858081
complement(1878)-c, adbSNP:139209095
complement(1908)-g, adbSNP:147235762
complement(1949)-t, adbSNP:201698323
complement(1969)-t, cdbSNP:145340027
complement(1971)-g, adbSNP:374813942
complement(2025)-g, adbSNP:371261235
complement(2043)-g, adbSNP:367743519
complement(2105)-c, adbSNP:147482520
complement(2122)-dbSNP:
complement(2122)-c, adbSNP:267599805
complement(2134)-t, cdbSNP:377708955
complement(2157)-g, adbSNP:199787775
complement(2170)-c, adbSNP:138751097
complement(2195)-g, adbSNP:373216811
complement(2221)-g, cdbSNP:137906740
complement(2222)-c, adbSNP:201342036
complement(2255)-g, adbSNP:369656358
complement(2266)-g, adbSNP:374341474
complement(2282)-dbSNP:
complement(2282)-g, adbSNP:139988577
complement(2321)-t, cdbSNP:200304117
complement(2324)-g, adbSNP:150501065
complement(2340)-g, adbSNP:370722965
complement(2341)-t, cdbSNP:148851890
complement(2366)-t, cdbSNP:111788645
complement(2428)-c, adbSNP:145712124
complement(2431)-t, cdbSNP:77049337
complement(2441)-t, cdbSNP:139861061
complement(2443)-t, cdbSNP:148748248
complement(2450)-t, cdbSNP:201068959
complement(2464)-t, cdbSNP:144304164
complement(2475)-t, gdbSNP:146028829
complement(2476)-t, cdbSNP:199535863
complement(2498)-t, adbSNP:137858823
complement(2530)-g, adbSNP:140158387
complement(2535)-g, adbSNP:371174915
complement(2554)-t, cdbSNP:375274122
complement(2625)-c, adbSNP:143092568
complement(2635)-t, gdbSNP:201330370
complement(2650)-dbSNP:
complement(2650)-g, cdbSNP:191056911
complement(2658)-g, adbSNP:148963942
complement(2668)-g, adbSNP:368148239
complement(2687)-t, gdbSNP:375765886
complement(2702)-g, adbSNP:370965011
complement(2703)-t, cdbSNP:142531478
complement(2709)-g, adbSNP:368637625
complement(2713)-t, cdbSNP:375924387
complement(2737)-t, cdbSNP:201054824
complement(2746)-g, adbSNP:370208223
complement(2747)-t, cdbSNP:267599804
complement(2757)-t, gdbSNP:200993949
complement(2767)-g, adbSNP:267599803
complement(2814)-g, adbSNP:200870389
complement(2816)-g, adbSNP:202174472
complement(2817)-g, adbSNP:374319726
complement(2832)-c, adbSNP:141861200
complement(2833)-g, adbSNP:372907454
complement(2834)-g, adbSNP:11707331
complement(2842)-g, cdbSNP:145694222
complement(2850)-t, cdbSNP:7374804
complement(2854)-g, adbSNP:370880796
complement(2884)-t, cdbSNP:57326399
complement(2894)-t, cdbSNP:367725043
complement(2930)-g, adbSNP:200163378
complement(2937)-g, adbSNP:59468016
complement(2972)-g, adbSNP:138413438
complement(2973)-t, cdbSNP:201397469
complement(2988)-g, adbSNP:375913659
complement(2994)-g, adbSNP:200267333
complement(3007)-t, cdbSNP:150111722
complement(3010)-c, adbSNP:186031413
complement(3020)-t, cdbSNP:199641736
complement(3047)-t, adbSNP:200601591
complement(3070)-t, cdbSNP:201106879
complement(3094)-dbSNP:
complement(3094)-g, adbSNP:371331011
complement(3102)-t, cdbSNP:369602237
complement(3109)-t, cdbSNP:376815753
complement(3130)-t, cdbSNP:147093541
complement(3133)-t, gdbSNP:73062575
complement(3138)-t, cdbSNP:371613636
complement(3151)-t, cdbSNP:374447261
complement(3173)-g, adbSNP:370202955
complement(3174)-t, adbSNP:149136109
complement(3192)-t, cdbSNP:6791171
complement(3218)-g, adbSNP:6795970
complement(3238)-dbSNP:
complement(3238)-t, cdbSNP:376528831
complement(3255)-t, cdbSNP:143610297
complement(3264)-t, cdbSNP:139332101
complement(3275)-g, adbSNP:12632942
complement(3291)-g, cdbSNP:148041371
complement(3311)-g, adbSNP:376090722
complement(3315)-t, gdbSNP:267599802
complement(3328)-g, cdbSNP:201871493
complement(3361)-dbSNP:
complement(3361)-t, gdbSNP:146965005
complement(3362)-t, cdbSNP:201588811
complement(3371)-g, adbSNP:143208505
complement(3379)-t, adbSNP:150260693
complement(3393)-g, cdbSNP:6771157
complement(3417)-g, cdbSNP:143744796
complement(3421)-t, cdbSNP:112412281
complement(3425)-t, cdbSNP:200584416
complement(3439)-g, adbSNP:373470651
complement(3440)-t, cdbSNP:375926577
complement(3442)-t, adbSNP:201827217
complement(3466)-t, cdbSNP:199542685
complement(3474)-g, cdbSNP:145568435
complement(3482)-g, adbSNP:200713724
complement(3509)-dbSNP:
complement(3509)-t, g, adbSNP:267599801
complement(3510)-g, adbSNP:267599800
complement(3542)-g, adbSNP:150773437
complement(3555)-c, adbSNP:201025253
complement(3556)-t, gdbSNP:192493052
complement(3585)-g, adbSNP:368972137
complement(3591)-g, adbSNP:374566362
complement(3598)-t, cdbSNP:202199966
complement(3670)-g, adbSNP:200597401
complement(3674)-g, adbSNP:139638446
complement(3675)-c, adbSNP:371834340
complement(3692)-dbSNP:
complement(3692)-g, adbSNP:147130891
complement(3695)-c, adbSNP:373750985
complement(3705)-t, cdbSNP:147376215
complement(3711)-t, adbSNP:148339462
complement(3748)-g, adbSNP:202134330
complement(3753)-t, gdbSNP:144350950
complement(3757)-t, gdbSNP:145909172
complement(3783)-c, adbSNP:367618914
complement(3796)-t, cdbSNP:199892190
complement(3803)-t, cdbSNP:138832868
complement(3811)-dbSNP:
complement(3811)-t, cdbSNP:371258438
complement(3822)-t, cdbSNP:368154191
complement(3828)-g, adbSNP:375572917
complement(3838)-t, adbSNP:200324539
complement(3845)-g, adbSNP:371378512
complement(3852)-g, adbSNP:147549873
complement(3859)-t, cdbSNP:145032037
complement(3893)-g, adbSNP:377708853
complement(3910)-c, adbSNP:142173735
complement(3943)-t, cdbSNP:147640811
complement(3958)-g, adbSNP:373466551
complement(3972)-t, cdbSNP:149883899
complement(3990)-c, adbSNP:149685953
complement(4009)-t, adbSNP:11711062
complement(4053)-g, adbSNP:139073590
complement(4063)-t, cdbSNP:375458594
complement(4069)-t, adbSNP:199703203
complement(4092)-dbSNP:
complement(4092)-t, gdbSNP:139436496
complement(4112)-t, cdbSNP:376193439
complement(4113)-g, cdbSNP:138786127
complement(4138)-g, adbSNP:371600996
complement(4139)-t, cdbSNP:149155352
complement(4173)-dbSNP:
complement(4173)-g, adbSNP:374352107
complement(4179)-g, adbSNP:150442007
complement(4192)-g, adbSNP:201234101
complement(4208)-g, adbSNP:140825889
complement(4212)-g, adbSNP:370960686
complement(4217)-g, cdbSNP:201280426
complement(4312)-dbSNP:
complement(4312)-t, cdbSNP:370610736
complement(4323)-t, cdbSNP:6790627
complement(4348)-t, cdbSNP:202131976
complement(4378)-g, adbSNP:148619598
complement(4379)-t, cdbSNP:369399424
complement(4380)-t, cdbSNP:376437999
complement(4396)-dbSNP:
complement(4396)-g, adbSNP:199931920
complement(4416)-g, adbSNP:144944369
complement(4485)-t, cdbSNP:267599799
complement(4491)-c, adbSNP:201148315
complement(4514)-g, adbSNP:184521520
complement(4515)-t, cdbSNP:191624001
complement(4525)-t, cdbSNP:187118004
complement(4533)-g, adbSNP:267599798
complement(4551)-g, adbSNP:139655085
complement(4552)-t, cdbSNP:202040659
complement(4568)-t, cdbSNP:142217269
complement(4573)-t, cdbSNP:373085099
complement(4581)-t, cdbSNP:369978695
complement(4584)-g, adbSNP:141828577
complement(4623)-t, cdbSNP:143688921
complement(4639)-c, adbSNP:377492327
complement(4656)-t, cdbSNP:151182542
complement(4675)-dbSNP:
complement(4675)-t, cdbSNP:369399641
complement(4694)-t, cdbSNP:200063383
complement(4710)-t, cdbSNP:78425180
complement(4723)-t, cdbSNP:140694303
complement(4762)-t, gdbSNP:142537392
complement(4763)-t, cdbSNP:376439863
complement(4780)-g, adbSNP:373347787
complement(4798)-g, adbSNP:201461161
complement(4818)-g, adbSNP:368992843
complement(4830)-g, adbSNP:139221219
complement(4849)-c, adbSNP:375940680
complement(4866)-g, adbSNP:6599242
complement(4872)-g, adbSNP:149642957
complement(4878)-t, cdbSNP:371337228
complement(4887..4888)-, gdbSNP:71635874
complement(4893)-g, adbSNP:139127319
complement(4915)-t, cdbSNP:368582725
complement(4917)-g, adbSNP:142804903
complement(4923)-t, cdbSNP:267599797
complement(4956)-t, cdbSNP:148256707
complement(4959)-g, adbSNP:150301002
complement(4976)-g, adbSNP:200761212
complement(4984)-t, cdbSNP:151090729
complement(5022)-t, cdbSNP:112795612
complement(5026)-g, cdbSNP:147627083
complement(5047)-g, adbSNP:146999807
complement(5078)-t, cdbSNP:145756648
complement(5089)-t, cdbSNP:77804526
complement(5093)-c, adbSNP:201985536
complement(5101)-g, adbSNP:199541482
complement(5137)-t, cdbSNP:6599241
complement(5199)-g, adbSNP:113721356
complement(5200)-t, cdbSNP:200645452
complement(5217)-g, adbSNP:116353929
complement(5245)-t, cdbSNP:141767849
complement(5249)-t, cdbSNP:145589241
complement(5256)-g, adbSNP:138532656
complement(5263)-t, cdbSNP:371924465
complement(5294)-g, adbSNP:369137515
complement(5295)-t, cdbSNP:145313578
complement(5306)-t, gdbSNP:377121469
complement(5342)-t, cdbSNP:372368062
complement(5345)-t, cdbSNP:267599796
complement(5358)-g, adbSNP:188413410
complement(5365)-t, cdbSNP:375735101
complement(5370)-c, adbSNP:140566252
complement(5371)-t, gdbSNP:371803816
complement(5379)-g, adbSNP:367612792
complement(5382)-g, adbSNP:184021595
complement(5436)-t, cdbSNP:201753955
complement(5445)-g, adbSNP:111535651
complement(5496)-g, adbSNP:112374164
complement(5523)-t, cdbSNP:147245558
complement(5532)-t, gdbSNP:370553488
complement(5539)-g, adbSNP:199503439
complement(5540)-t, cdbSNP:148537653
complement(5548)-g, adbSNP:149504103
complement(5576)-t, gdbSNP:146269698
complement(5583)-g, cdbSNP:374422986
complement(5587)-g, adbSNP:370779258
complement(5588)-t, cdbSNP:191869263
complement(5594)-t, cdbSNP:377518708
complement(5600)-c, adbSNP:373299553
complement(5603)-t, gdbSNP:115463830
complement(5605)-g, adbSNP:141648641
complement(5613)-t, cdbSNP:370483003
complement(5628)-g, cdbSNP:147660344
complement(5630)-g, adbSNP:143523403
complement(5656)-t, cdbSNP:148979438
complement(5657)-g, adbSNP:142653846
complement(5685)-g, adbSNP:373128353
complement(5721)-t, gdbSNP:376432760
complement(5739)-g, adbSNP:369390668
complement(5757)-t, cdbSNP:145340685
complement(5764)-t, cdbSNP:376810032
complement(5780)-t, cdbSNP:201024779
complement(5834)-t, cdbSNP:372702302
Gene SymbolSCN10A
Gene SynonymFEPS2; hPN3; Nav1.8; PN3; SNS
Chromosome3
Locus Map3p22.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006514 Homo sapiens sodium channel, voltage-gated, type X, alpha subunit (SCN10A), transcript variant 1, mRNA. On-demand $2699.00 30
NM_006514 Homo sapiens sodium channel, voltage-gated, type X, alpha subunit (SCN10A), transcript variant 1, mRNA. On-demand $2699.00 30
NM_006514 Homo sapiens sodium channel, voltage-gated, type X, alpha subunit (SCN10A), transcript variant 1, mRNA. On-demand $2699.00 30
NM_006514 Homo sapiens sodium channel, voltage-gated, type X, alpha subunit (SCN10A), transcript variant 1, mRNA. On-demand $2699.00 30
Title Exon 11 skipping of SCN10A coding for voltage-gated sodium channels in dorsal root ganglia .
Author Schirmeyer J, Szafranski K, Leipold E, Mawrin C, Platzer M and Heinemann SH.
Journal Channels (Austin) 8 (3) (2014) In press
Title Common variants at SCN5A-SCN10A and HEY2 are associated with Brugada syndrome, a rare disease with high risk of sudden cardiac death .
Author Bezzina CR, Barc J, Mizusawa Y, Remme CA, Gourraud JB, Simonet F, Verkerk AO, Schwartz PJ, Crotti L, Dagradi F, Guicheney P, Fressart V, Leenhardt A, Antzelevitch C, Bartkowiak S, Borggrefe M, Schimpf R, Schulze-Bahr E, Zumhagen S, Behr ER, Bastiaenen R, Tfelt-Hansen J, Olesen MS, Kaab S, Beckmann BM, Weeke P, Watanabe H, Endo N, Minamino T, Horie M, Ohno S, Hasegawa K, Makita N, Nogami A, Shimizu W, Aiba T, Froguel P, Balkau B, Lantieri O, Torchio M, Wiese C, Weber D, Wolswinkel R, Coronel R, Boukens BJ, Bezieau S, Charpentier E, Chatel S, Despres A, Gros F, Kyndt F, Lecointe S, Lindenbaum P, Portero V, Violleau J, Gessler M, Tan HL, Roden DM, Christoffels VM, Le Marec H, Wilde AA, Probst V, Schott JJ, Dina C and Redon R.
Journal Nat. Genet. 45 (9), 1044-1049 (2013)
Title Small-fiber neuropathy Nav1.8 mutation shifts activation to hyperpolarized potentials and increases excitability of dorsal root ganglion neurons .
Author Huang J, Yang Y, Zhao P, Gerrits MM, Hoeijmakers JG, Bekelaar K, Merkies IS, Faber CG, Dib-Hajj SD and Waxman SG.
Journal J. Neurosci. 33 (35), 14087-14097 (2013)
Title Genome- and phenome-wide analyses of cardiac conduction identifies markers of arrhythmia risk .
Author Ritchie MD, Denny JC, Zuvich RL, Crawford DC, Schildcrout JS, Bastarache L, Ramirez AH, Mosley JD, Pulley JM, Basford MA, Bradford Y, Rasmussen LV, Pathak J, Chute CG, Kullo IJ, McCarty CA, Chisholm RL, Kho AN, Carlson CS, Larson EB, Jarvik GP, Sotoodehnia N, Manolio TA, Li R, Masys DR, Haines JL and Roden DM.
Journal Circulation 127 (13), 1377-1385 (2013)
Title Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians .
Author Yang W, Tang H, Zhang Y, Tang X, Zhang J, Sun L, Yang J, Cui Y, Zhang L, Hirankarn N, Cheng H, Pan HF, Gao J, Lee TL, Sheng Y, Lau CS, Li Y, Chan TM, Yin X, Ying D, Lu Q, Leung AM, Zuo X, Chen X, Tong KL, Zhou F, Diao Q, Tse NK, Xie H, Mok CC, Hao F, Wong SN, Shi B, Lee KW, Hui Y, Ho MH, Liang B, Lee PP, Cui H, Guo Q, Chung BH, Pu X, Liu Q, Zhang X, Zhang C, Chong CY, Fang H, Wong RW, Sun Y, Mok MY, Li XP, Avihingsanon Y, Zhai Z, Rianthavorn P, Deekajorndej T, Suphapeetiporn K, Gao F, Shotelersuk V, Kang X, Ying SK, Zhang L, Wong WH, Zhu D, Fung SK, Zeng F, Lai WM, Wong CM, Ng IO, Garcia-Barcelo MM, Cherny SS, Shen N, Tam PK, Sham PC, Ye DQ, Yang S, Zhang X and Lau YL.
Journal Am. J. Hum. Genet. 92 (1), 41-51 (2013)
Title A high-capacity membrane potential FRET-based assay for NaV1.8 channels .
Author Liu CJ, Priest BT, Bugianesi RM, Dulski PM, Felix JP, Dick IE, Brochu RM, Knaus HG, Middleton RE, Kaczorowski GJ, Slaughter RS, Garcia ML and Kohler MG.
Journal Assay Drug Dev Technol 4 (1), 37-48 (2006)
Title International Union of Pharmacology. XLVII. Nomenclature and structure-function relationships of voltage-gated sodium channels .
Author Catterall WA, Goldin AL and Waxman SG.
Journal Pharmacol. Rev. 57 (4), 397-409 (2005)
Title Sensory neuron proteins interact with the intracellular domains of sodium channel NaV1.8 .
Author Malik-Hall M, Poon WY, Baker MD, Wood JN and Okuse K.
Journal Brain Res. Mol. Brain Res. 110 (2), 298-304 (2003)
Title Evolution and diversity of mammalian sodium channel genes .
Author Plummer NW and Meisler MH.
Journal Genomics 57 (2), 323-331 (1999)
Title A tetrodotoxin-resistant voltage-gated sodium channel from human dorsal root ganglia, hPN3/SCN10A .
Author Rabert DK, Koch BD, Ilnicka M, Obernolte RA, Naylor SL, Herman RC, Eglen RM, Hunter JC and Sangameswaran L.
Journal Pain 78 (2), 107-114 (1998)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.