• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens zinc finger protein 217 (ZNF217), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_006526 Homo sapiens zinc finger protein 217 (ZNF217), mRNA. GenEZ ORF Cloning On-demand $1699.00 25

*Business Day

Related Services

RefSeq Version NM_006526.2, 40807454
Length 5653 bp
Structure linear
Update Date 19-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens zinc finger protein 217 (ZNF217), mRNA.
Product zinc finger protein 217
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AF041259.1 and BC039055.1. On Jan 13, 2004 this sequence version replaced gi:5730123.

RefSeq NP_006517.1
CDS 272..3418
Misc Feature(1)263..265
Misc Feature(2)1232..1234
Misc Feature(3)1232..1234
Misc Feature(4)1235..1237
Misc Feature(5)1490..1492
Misc Feature(6)1490..1492
Misc Feature(7)1685..1750
Misc Feature(8)1724..1801
Misc Feature(9)1979..1981
Misc Feature(10)2213..2215
Misc Feature(11)2255..2257
Misc Feature(12)2654..2656
Misc Feature(13)2654..2656
Misc Feature(14)2813..2815
Exon (1)1..1637
Gene:ZNF217
Gene Synonym:ZABC1
Exon (2)1638..1754
Gene:ZNF217
Gene Synonym:ZABC1
Exon (3)1755..3308
Gene:ZNF217
Gene Synonym:ZABC1
Exon (4)3309..3441
Gene:ZNF217
Gene Synonym:ZABC1
Exon (5)3442..5635
Gene:ZNF217
Gene Synonym:ZABC1
Translation MQSKVTGNMPTQSLLMYMDGPEVIGSSLGSPMEMEDALSMKGTAVVPFRATQEKNVIQIE GYMPLDCMFCSQTFTHSEDLNKHVLMQHRPTLCEPAVLRVEAEYLSPLDKSQVRTEPPKE KNCKENEFSCEVCGQTFRVAFDVEIHMRTHKDSFTYGCNMCGRRFKEPWFLKNHMRTHNG KSGARSKLQQGLESSPATINEVVQVHAAESISSPYKICMVCGFLFPNKESLIEHRKVHTK KTAFGTSSAQTDSPQGGMPSSREDFLQLFNLRPKSHPETGKKPVRCIPQLDPFTTFQAWQ LATKGKVAICQEVKESGQEGSTDNDDSSSEKELGETNKGSCAGLSQEKEKCKHSHGEAPS VDADPKLPSSKEKPTHCSECGKAFRTYHQLVLHSRVHKKDRRAGAESPTMSVDGRQPGTC SPDLAAPLDENGAVDRGEGGSEDGSEDGLPEGIHLDKNDDGGKIKHLTSSRECSYCGKFF RSNYYLNIHLRTHTGEKPYKCEFCEYAAAQKTSLRYHLERHHKEKQTDVAAEVKNDGKNQ DTEDALLTADSAQTKNLKRFFDGAKDVTGSPPAKQLKEMPSVFQNVLGSAVLSPAHKDTQ DFHKNAADDSADKVNKNPTPAYLDLLKKRSAVETQANNLICRTKADVTPPPDGSTTHNLE VSPKEKQTETAADCRYRPSVDCHEKPLNLSVGALHNCPAISLSKSLIPSITCPFCTFKTF YPEVLMMHQRLEHKYNPDVHKNCRNKSLLRSRRTGCPPALLGKDVPPLSSFCKPKPKSAF PAQSKSLPSAKGKQSPPGPGKAPLTSGIDSSTLAPSNLKSHRPQQNVGVQGAATRQQQSE MFPKTSVSPAPDKTKRPETKLKPLPVAPSQPTLGSSNINGSIDYPAKNDSPWAPPGRDYF CNRSASNTAAEFGEPLPKRLKSSVVALDVDQPGANYRRGYDLPKYHMVRGITSLLPQDCV YPSQALPPKPRFLSSSEVDSPNVLTVQKPYGGSGPLYTCVPAGSPASSSTLEGKRPVSYQ HLSNSMAQKRNYENFIGNAHYRPNDKKT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(62)-dbSNP:
complement(62)-t, gdbSNP:149083919
142+c, tdbSNP:3748501
complement(164)-g, adbSNP:147702769
complement(171)-g, adbSNP:145428717
complement(267)-t, cdbSNP:376397694
complement(272)-t, cdbSNP:148640799
complement(280)-t, cdbSNP:200038482
complement(307)-t, cdbSNP:143915391
complement(363)-g, adbSNP:373514116
complement(371)-t, cdbSNP:190147248
complement(373)-t, cdbSNP:112729586
complement(395)-t, cdbSNP:149936905
complement(399)-t, gdbSNP:139129142
complement(400)-g, adbSNP:146282815
complement(401)-t, cdbSNP:141827117
complement(448)-g, adbSNP:138837480
complement(454)-t, cdbSNP:146056612
complement(525)-g, adbSNP:201521105
complement(545)-g, adbSNP:141818287
complement(591)-g, adbSNP:186962181
complement(593)-g, adbSNP:369417236
complement(601)-t, cdbSNP:111944343
complement(608)-t, cdbSNP:143693065
complement(643)-t, cdbSNP:375354732
complement(648)-t, cdbSNP:182254291
complement(658)-t, cdbSNP:35267451
complement(670)-g, adbSNP:1326862
complement(733)-g, adbSNP:199771630
complement(742)-t, cdbSNP:146917565
complement(749)-t, gdbSNP:142630651
complement(817)-t, cdbSNP:147735193
complement(891)-g, adbSNP:368882252
complement(895)-g, adbSNP:201777102
complement(900)-t, cdbSNP:200350390
complement(902)-t, cdbSNP:201437971
complement(907)-g, adbSNP:144205864
complement(922)-g, cdbSNP:187569795
complement(1001)-g, adbSNP:377184373
complement(1003)-g, adbSNP:117626894
complement(1004)-t, cdbSNP:150961799
complement(1017)-g, adbSNP:372777442
complement(1018)-c, adbSNP:78786003
complement(1055)-t, cdbSNP:181973495
complement(1057)-t, cdbSNP:192030059
complement(1108)-t, cdbSNP:376477737
complement(1120)-t, adbSNP:111743123
complement(1165)-t, cdbSNP:34873389
complement(1188)-t, cdbSNP:113988930
complement(1218)-g, adbSNP:370070088
complement(1243)-g, adbSNP:146015661
complement(1249)-g, adbSNP:199678396
complement(1252)-t, cdbSNP:149567563
complement(1253)-t, cdbSNP:139246692
complement(1297)-t, adbSNP:16998248
complement(1316)-t, cdbSNP:141467941
complement(1332)-g, adbSNP:367758885
complement(1345)-t, cdbSNP:374457302
complement(1350)-g, adbSNP:139287977
complement(1352)-t, cdbSNP:146782561
complement(1357)-g, adbSNP:201278892
complement(1359)-g, adbSNP:111868842
complement(1364)-g, cdbSNP:186676017
complement(1374)-g, cdbSNP:138564422
complement(1396)-t, adbSNP:181352601
complement(1418)-t, cdbSNP:377050757
complement(1432)-g, adbSNP:373588537
complement(1480)-g, adbSNP:370879545
complement(1495)-g, cdbSNP:143799755
complement(1499)-t, cdbSNP:6068589
complement(1505)-g, cdbSNP:377511134
complement(1543)-g, adbSNP:73280089
complement(1546)-g, adbSNP:150335718
complement(1553)-g, cdbSNP:373838524
complement(1579)-t, cdbSNP:140282485
complement(1584)-t, cdbSNP:185310161
complement(1589)-t, cdbSNP:368687800
complement(1622)-t, cdbSNP:200131894
complement(1674)-dbSNP:
complement(1674)-g, adbSNP:146682558
complement(1852)-dbSNP:
complement(1852)-t, cdbSNP:34614052
complement(1876)-g, adbSNP:7270855
complement(1878)-t, adbSNP:367559246
complement(1886)-t, cdbSNP:373699049
complement(1909)-t, cdbSNP:368751664
1914+c, tdbSNP:35720349
complement(1915)-g, adbSNP:142672146
complement(1926)-g, adbSNP:148520971
complement(1986)-g, adbSNP:374658874
complement(2032)-t, cdbSNP:61748380
complement(2038)-g, adbSNP:149340223
complement(2042)-t, cdbSNP:199663263
complement(2049)-g, adbSNP:201305259
complement(2071)-t, cdbSNP:200006230
complement(2095)-g, adbSNP:192159733
complement(2126)-t, adbSNP:371073214
complement(2203)-t, cdbSNP:140823328
complement(2205)-g, c, adbSNP:147264830
2206+a, gdbSNP:3748503
complement(2206)-t, cdbSNP:386585379
complement(2212)-g, adbSNP:138465815
complement(2215)-g, adbSNP:150490429
complement(2222)-g, adbSNP:267606004
complement(2224)-t, cdbSNP:202034493
complement(2258)-g, adbSNP:370634538
complement(2281)-g, adbSNP:146851813
complement(2341)-g, adbSNP:377601068
complement(2348)-t, cdbSNP:373031118
complement(2355)-t, cdbSNP:200865401
complement(2360)-g, adbSNP:143450020
complement(2364)-g, adbSNP:369074794
complement(2424)-t, cdbSNP:377457558
complement(2452)-t, cdbSNP:370724501
complement(2480)-g, adbSNP:373473921
complement(2485)-g, adbSNP:140208007
complement(2486)-t, cdbSNP:6063966
complement(2511)-g, adbSNP:144638963
complement(2512)-g, adbSNP:372042008
complement(2514)-c, adbSNP:373164736
complement(2533)-g, adbSNP:141041836
complement(2542)-t, cdbSNP:56268939
complement(2548)-t, cdbSNP:149968476
complement(2573)-g, adbSNP:139205711
complement(2576)-g, adbSNP:2766676
complement(2596)-t, cdbSNP:369174864
2600+g, tdbSNP:7351440
complement(2613)-g, adbSNP:144642118
complement(2614)-t, cdbSNP:140678854
complement(2617)-g, cdbSNP:41274708
complement(2630)-g, adbSNP:375003584
complement(2634)-g, adbSNP:371706071
complement(2640)-t, gdbSNP:367766581
complement(2652)-t, cdbSNP:13039828
complement(2697)-t, adbSNP:375404549
complement(2715)-g, adbSNP:372304693
complement(2723)-g, adbSNP:142037742
complement(2730)-g, adbSNP:145426629
complement(2739)-g, adbSNP:200721007
complement(2761)-t, g, cdbSNP:140132916
complement(2785)-t, cdbSNP:6097490
complement(2796)-t, adbSNP:368652297
complement(2823)-g, adbSNP:375628117
complement(2866)-t, cdbSNP:138944883
complement(2876)-t, cdbSNP:34533727
complement(2880)-t, cdbSNP:141544587
complement(2883)-g, adbSNP:138518570
complement(2884)-c, adbSNP:35556360
complement(2907)-t, cdbSNP:371075866
complement(2926)-g, cdbSNP:35736239
complement(2927)-t, cdbSNP:112155907
complement(2935)-g, adbSNP:147997293
2937+a, g, tdbSNP:34323943
complement(2944)-t, cdbSNP:148869536
complement(2979)-t, cdbSNP:61748378
complement(3004)-t, cdbSNP:377522485
complement(3010)-g, adbSNP:374046123
complement(3013)-c, adbSNP:61730988
complement(3014)-g, adbSNP:61730989
complement(3037)-g, adbSNP:201769133
complement(3040)-g, adbSNP:199644149
complement(3041)-t, cdbSNP:376210645
complement(3055)-g, adbSNP:200554750
complement(3062)-g, cdbSNP:41274706
complement(3089)-g, adbSNP:139310891
complement(3090)-t, cdbSNP:150838493
complement(3121)-g, adbSNP:11906913
complement(3122)-t, cdbSNP:376508387
complement(3157)-t, cdbSNP:45439395
complement(3159)-g, adbSNP:144407647
3166+a, gdbSNP:34495111
complement(3187)-t, gdbSNP:373059588
complement(3199)-g, adbSNP:201787589
complement(3200)-t, cdbSNP:376006308
complement(3205)-g, adbSNP:138549650
complement(3210)-t, gdbSNP:200227643
complement(3220)-t, cdbSNP:145942740
complement(3240)-t, cdbSNP:371730112
complement(3266)-c, adbSNP:61758384
complement(3271)-g, cdbSNP:137994648
3277+c, tdbSNP:34490301
complement(3300)-g, adbSNP:140333644
complement(3301)-t, cdbSNP:111986142
complement(3312)-dbSNP:
complement(3312)-t, cdbSNP:370520924
complement(3325)-t, adbSNP:36029677
complement(3328)-g, adbSNP:368172658
complement(3338)-g, adbSNP:202119672
complement(3421)-g, adbSNP:370225308
complement(3505)-dbSNP:
complement(3505)-t, cdbSNP:75039525
complement(3557)-g, adbSNP:377312666
complement(3675)-g, adbSNP:57693460
complement(3684)-g, adbSNP:183152406
complement(3781)-t, cdbSNP:375051439
complement(3790..3791)-, tcdbSNP:35019294
complement(3812)-g, adbSNP:138302272
3919+c, tdbSNP:150468949
complement(3924)-g, adbSNP:114467604
complement(3943..3944)-, aadbSNP:76243761
complement(4301)-t, cdbSNP:1555926
complement(4336)-g, adbSNP:117071158
complement(4339)-t, cdbSNP:140545580
complement(4350)-g, adbSNP:6022598
complement(4569)-t, cdbSNP:78062824
complement(4576)-t, cdbSNP:375899390
complement(4590)-g, adbSNP:6091705
complement(4689)-g, adbSNP:6022597
complement(4708)-t, cdbSNP:189990658
complement(4731)-g, cdbSNP:73280081
complement(4743)-t, cdbSNP:2766671
complement(4800)-g, adbSNP:201052742
complement(4860)-t, adbSNP:718890
complement(4861)-t, adbSNP:718889
complement(4862)-t, adbSNP:76344141
complement(4873..4874)-, adbSNP:202166411
complement(5114)-g, adbSNP:370845094
complement(5227)-, tdbSNP:34748119
complement(5227)-, tdbSNP:397864778
complement(5264)-t, cdbSNP:191012722
complement(5432)-g, adbSNP:76980304
complement(5529..5532)-, taagdbSNP:142172004
5540+a, gdbSNP:1056948
5556+g, tdbSNP:1056949
complement(5629..5633)-, gcaaadbSNP:369079322
Gene SymbolZNF217
Gene SynonymZABC1
Chromosome20
Locus Map20q13.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006526 Homo sapiens zinc finger protein 217 (ZNF217), mRNA. On-demand $1699.00 25
XM_006723875 PREDICTED: Homo sapiens zinc finger protein 217 (ZNF217), transcript variant X2, mRNA. On-demand $1699.00 25
XM_005260545 PREDICTED: Homo sapiens zinc finger protein 217 (ZNF217), transcript variant X1, mRNA. On-demand $1699.00 25
Title New insights into DNA recognition by zinc fingers revealed by structural analysis of the oncoprotein ZNF217 .
Author Vandevenne M, Jacques DA, Artuz C, Nguyen CD, Kwan AH, Segal DJ, Matthews JM, Crossley M, Guss JM and Mackay JP.
Journal J. Biol. Chem. 288 (15), 10616-10627 (2013)
Title Identification of ZNF217, hnRNP-K, VEGF-A and IPO7 as targets for microRNAs that are downregulated in prostate carcinoma .
Author Szczyrba J, Nolte E, Hart M, Doll C, Wach S, Taubert H, Keck B, Kremmer E, Stohr R, Hartmann A, Wieland W, Wullich B and Grasser FA.
Journal Int. J. Cancer 132 (4), 775-784 (2013)
Title Gene amplification of ZNF217 located at chr20q13.2 is associated with lymph node metastasis in ovarian clear cell carcinoma .
Author Rahman MT, Nakayama K, Rahman M, Katagiri H, Katagiri A, Ishibashi T, Ishikawa M, Iida K, Nakayama N, Otsuki Y, Nakayama S and Miyazaki K.
Journal Anticancer Res. 32 (8), 3091-3095 (2012)
Title The transcription factor ZNF217 is a prognostic biomarker and therapeutic target during breast cancer progression .
Author Littlepage LE, Adler AS, Kouros-Mehr H, Huang G, Chou J, Krig SR, Griffith OL, Korkola JE, Qu K, Lawson DA, Xue Q, Sternlicht MD, Dijkgraaf GJ, Yaswen P, Rugo HS, Sweeney CA, Collins CC, Gray JW, Chang HY and Werb Z.
Journal Cancer Discov 2 (7), 638-651 (2012)
Title Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population .
Author Comuzzie AG, Cole SA, Laston SL, Voruganti VS, Haack K, Gibbs RA and Butte NF.
Journal PLoS ONE 7 (12), E51954 (2012)
Title A candidate X-linked mental retardation gene is a component of a new family of histone deacetylase-containing complexes .
Author Hakimi MA, Dong Y, Lane WS, Speicher DW and Shiekhattar R.
Journal J. Biol. Chem. 278 (9), 7234-7239 (2003)
Title The DNA sequence and comparative analysis of human chromosome 20 .
Author Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S and Rogers J.
Journal Nature 414 (6866), 865-871 (2001)
Title The ZNF217 gene amplified in breast cancers promotes immortalization of human mammary epithelial cells .
Author Nonet GH, Stampfer MR, Chin K, Gray JW, Collins CC and Yaswen P.
Journal Cancer Res. 61 (4), 1250-1254 (2001)
Title Positional cloning of ZNF217 and NABC1: genes amplified at 20q13.2 and overexpressed in breast carcinoma .
Author Collins C, Rommens JM, Kowbel D, Godfrey T, Tanner M, Hwang SI, Polikoff D, Nonet G, Cochran J, Myambo K, Jay KE, Froula J, Cloutier T, Kuo WL, Yaswen P, Dairkee S, Giovanola J, Hutchinson GB, Isola J, Kallioniemi OP, Palazzolo M, Martin C, Ericsson C, Pinkel D, Albertson D, Li WB and Gray JW.
Journal Proc. Natl. Acad. Sci. U.S.A. 95 (15), 8703-8708 (1998)
Title Detection and mapping of amplified DNA sequences in breast cancer by comparative genomic hybridization .
Author Kallioniemi A, Kallioniemi OP, Piper J, Tanner M, Stokke T, Chen L, Smith HS, Pinkel D, Gray JW and Waldman FM.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (6), 2156-2160 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.