• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens guanine nucleotide binding protein (G protein), alpha 13 (GNA13), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_006572 Homo sapiens guanine nucleotide binding protein (G protein), alpha 13 (GNA13), mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_006572.4, 215820623
Length 6311 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens guanine nucleotide binding protein (G protein), alpha 13 (GNA13), mRNA.
Product guanine nucleotide-binding protein subunit alpha-13
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DC335364.1, BC036756.1 and AC037487.12. On Dec 5, 2008 this sequence version replaced gi:31343475.

RefSeq NP_006563.2
CDS 210..1343
Misc Feature(1)249..251
Misc Feature(2)249..251
Misc Feature(3)261..263
Misc Feature(4)294..1334
Misc Feature(5)318..320
Misc Feature(6)354..1322
Misc Feature(7)order(372..374,387..395,816..818,873..875,882..884,
Misc Feature(8)372..395
Misc Feature(9)order(375..383,465..467,477..479,489..491,498..500,
Misc Feature(10)801..827
Misc Feature(11)816..818
Misc Feature(12)816..818
Misc Feature(13)816..818
Misc Feature(14)order(819..821,825..827,831..833,864..866,870..872,
Misc Feature(15)order(825..827,900..902,909..914,921..923)
Misc Feature(16)873..884
Misc Feature(17)876..926
Misc Feature(18)1080..1091
Misc Feature(19)order(1227..1262,1266..1277)
Misc Feature(20)1251..1259
Exon (1)1..492
Gene:GNA13
Gene Synonym:G13
Exon (2)493..719
Gene:GNA13
Gene Synonym:G13
Exon (3)720..770
Gene:GNA13
Gene Synonym:G13
Exon (4)771..6311
Gene:GNA13
Gene Synonym:G13
Translation MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESG KSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGD KMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFLDN LDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSV TSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENIRLVFR DVKDTILHDNLKQLMLQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(160..162)-dbSNP:
complement(160..162)-, cctdbSNP:149160490
complement(204..206)-, gccdbSNP:200801511
complement(206..207)-, ggcggcdbSNP:3830470
complement(242)-c, adbSNP:200827295
complement(251)-g, adbSNP:200798977
complement(340)-t, adbSNP:201316886
complement(355)-t, gdbSNP:78590636
complement(359)-g, adbSNP:2271282
complement(398)-g, adbSNP:149393322
complement(401)-g, adbSNP:202180829
complement(515)-dbSNP:
complement(515)-c, adbSNP:75732860
complement(517)-t, cdbSNP:200512437
complement(529)-t, cdbSNP:200421130
complement(581)-t, cdbSNP:145081453
complement(611)-t, g, cdbSNP:201253039
complement(621)-g, cdbSNP:141288232
complement(630)-t, cdbSNP:116700192
complement(641)-t, cdbSNP:41300618
complement(654)-t, cdbSNP:201626569
complement(675)-t, cdbSNP:191483051
complement(677)-g, adbSNP:141132978
complement(692)-g, adbSNP:11656602
complement(694)-t, cdbSNP:150997140
complement(848)-dbSNP:
complement(848)-c, adbSNP:2230312
complement(870)-g, cdbSNP:1062597
complement(926)-g, adbSNP:112783387
complement(1010)-t, cdbSNP:61754625
complement(1038)-t, cdbSNP:113503987
complement(1045)-t, cdbSNP:199660009
complement(1112)-t, cdbSNP:201673014
complement(1148)-t, cdbSNP:145562983
complement(1200)-g, adbSNP:200032909
complement(1292)-g, adbSNP:183168548
complement(1302)-t, adbSNP:144334275
complement(1310)-t, cdbSNP:41306353
complement(1359)-g, cdbSNP:113119359
complement(1456)-g, adbSNP:143906965
complement(1489)-t, gdbSNP:112108969
complement(1535)-g, cdbSNP:114639799
complement(1569)-g, adbSNP:185757912
complement(1579)-t, cdbSNP:180869035
complement(1687)-c, adbSNP:140010742
complement(1830)-t, cdbSNP:80353801
complement(1944)-g, adbSNP:189181090
complement(2001)-t, cdbSNP:41300620
complement(2039)-c, adbSNP:147489674
complement(2160)-t, cdbSNP:78170638
complement(2239)-t, adbSNP:114591136
complement(2585)-t, cdbSNP:186345693
complement(2601)-g, adbSNP:181474447
complement(2632)-g, adbSNP:142964967
complement(2899)-t, cdbSNP:138727338
complement(2920..2921)-, accccdbSNP:144879210
complement(2937..2940)-, cagadbSNP:139410381
complement(2940)-c, adbSNP:190131614
complement(3059)-t, cdbSNP:150259100
complement(3063)-t, adbSNP:116664012
complement(3069)-t, cdbSNP:7342814
complement(3245)-g, adbSNP:75200830
complement(3267)-g, adbSNP:142033484
complement(3323)-t, cdbSNP:184858377
complement(3370)-t, gdbSNP:148137657
complement(3505)-t, cdbSNP:116270472
complement(3512)-t, cdbSNP:181465721
complement(3796)-t, cdbSNP:8076826
complement(4133)-t, gdbSNP:189857781
complement(4517)-t, cdbSNP:112253470
complement(4542)-g, adbSNP:55927114
complement(4580)-t, cdbSNP:183637284
complement(4623)-g, adbSNP:11870431
complement(4631)-g, adbSNP:146686590
complement(4799)-g, adbSNP:191493853
complement(4890)-t, cdbSNP:187786929
complement(5004)-g, adbSNP:185044336
complement(5014)-g, adbSNP:193087702
complement(5332)-t, adbSNP:188561776
complement(5417)-c, adbSNP:149021677
complement(5660)-t, gdbSNP:144892852
complement(5664)-t, cdbSNP:76790747
complement(5821)-t, cdbSNP:183685578
complement(5931)-t, gdbSNP:149955744
complement(5968)-t, cdbSNP:78234127
complement(5996)-g, adbSNP:139219658
complement(6043)-t, cdbSNP:151190402
complement(6093..6095)-, caadbSNP:57389796
complement(6129)-t, cdbSNP:117744809
complement(6246)-g, adbSNP:115295431
complement(6249)-g, adbSNP:56166445
complement(6283)-g, adbSNP:144382215
Gene SymbolGNA13
Gene SynonymG13
Chromosome17
Locus Map17q24.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006572 Homo sapiens guanine nucleotide binding protein (G protein), alpha 13 (GNA13), mRNA. In-stock $418.00 $369.00 10
Title Activation of p115-RhoGEF requires direct association of Galpha13 and the Dbl homology domain .
Author Chen,Z., Guo,L., Hadas,J., Gutowski,S., Sprang,S.R. and Sternweis,P.C.
Journal J. Biol. Chem. 287 (30), 25490-25500 (2012)
Title A synthetic biology approach reveals a CXCR4-G13-Rho signaling axis driving transendothelial migration of metastatic breast cancer cells .
Author Yagi,H., Tan,W., Dillenburg-Pilla,P., Armando,S., Amornphimoltham,P., Simaan,M., Weigert,R., Molinolo,A.A., Bouvier,M. and Gutkind,J.S.
Journal Sci Signal 4 (191), RA60 (2011)
Title The alpha subunit of the G protein G13 regulates activity of one or more Gli transcription factors independently of smoothened .
Author Douglas,A.E., Heim,J.A., Shen,F., Almada,L.L., Riobo,N.A., Fernandez-Zapico,M.E. and Manning,D.R.
Journal J. Biol. Chem. 286 (35), 30714-30722 (2011)
Title Negative regulation of Gq-mediated pathways in platelets by G(12/13) pathways through Fyn kinase .
Author Kim,S. and Kunapuli,S.P.
Journal J. Biol. Chem. 286 (27), 24170-24179 (2011)
Title G(alpha)12/13 induction of CYR61 in association with arteriosclerotic intimal hyperplasia: effect of sphingosine-1-phosphate .
Author Kim,Y.M., Lim,S.C., Han,C.Y., Kay,H.Y., Cho,I.J., Ki,S.H., Lee,M.Y., Kwon,H.M., Lee,C.H. and Kim,S.G.
Journal Arterioscler. Thromb. Vasc. Biol. 31 (4), 861-869 (2011)
Title Galpha12 and galpha13 are phosphorylated during platelet activation .
Author Offermanns,S., Hu,Y.H. and Simon,M.I.
Journal J. Biol. Chem. 271 (42), 26044-26048 (1996)
Title The human thyrotropin receptor: a heptahelical receptor capable of stimulating members of all four G protein families .
Author Laugwitz,K.L., Allgeier,A., Offermanns,S., Spicher,K., Van Sande,J., Dumont,J.E. and Schultz,G.
Journal Proc. Natl. Acad. Sci. U.S.A. 93 (1), 116-120 (1996)
Title Expression of GTP-binding protein alpha subunits in human thymocytes .
Author Kabouridis,P.S., Waters,S.T., Escobar,S., Stanners,J. and Tsoukas,C.D.
Journal Mol. Cell. Biochem. 144 (1), 45-51 (1995)
Title Mechanism of GTP hydrolysis by G-protein alpha subunits .
Author Kleuss,C., Raw,A.S., Lee,E., Sprang,S.R. and Gilman,A.G.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (21), 9828-9831 (1994)
Title G proteins of the G12 family are activated via thromboxane A2 and thrombin receptors in human platelets .
Author Offermanns,S., Laugwitz,K.L., Spicher,K. and Schultz,G.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (2), 504-508 (1994)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.