• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens guanine nucleotide binding protein (G protein), alpha 13 (GNA13), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu14245 Homo sapiens guanine nucleotide binding protein (G protein), alpha 13 (GNA13), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu14245C Homo sapiens guanine nucleotide binding protein (G protein), alpha 13 (GNA13), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_006572.5, 540344572
Length 1134 bp
Structure linear
Update Date 31-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens guanine nucleotide binding protein (G protein), alpha 13 (GNA13), transcript variant 1, mRNA.
Product guanine nucleotide-binding protein subunit alpha-13 isoform 1
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DC335364.1, AF493902.1, AC037487.12 and AW298099.1. On Sep 7, 2013 this sequence version replaced gi:215820623.


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_006563.2
CDS 210..1343
Misc Feature(1)249..251
Misc Feature(2)249..251
Misc Feature(3)261..263
Misc Feature(4)294..1334
Misc Feature(5)318..320
Misc Feature(6)354..1322
Misc Feature(7)order(372..374,387..395,816..818,873..875,882..884,
Misc Feature(8)372..395
Misc Feature(9)order(375..383,465..467,477..479,489..491,498..500,
Misc Feature(10)801..827
Misc Feature(11)816..818
Misc Feature(12)816..818
Misc Feature(13)816..818
Misc Feature(14)order(819..821,825..827,831..833,864..866,870..872,
Misc Feature(15)order(825..827,900..902,909..914,921..923)
Misc Feature(16)873..884
Misc Feature(17)876..926
Misc Feature(18)1080..1091
Misc Feature(19)order(1227..1262,1266..1277)
Misc Feature(20)1251..1259
Exon (1)1..492
Gene:GNA13
Gene Synonym:G13
Exon (2)493..719
Gene:GNA13
Gene Synonym:G13
Exon (3)720..770
Gene:GNA13
Gene Synonym:G13
Exon (4)771..6311
Gene:GNA13
Gene Synonym:G13
Translation MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESG KSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGD KMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFLDN LDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSV TSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENIRLVFR DVKDTILHDNLKQLMLQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(20..21)-dbSNP:
complement(20..21)-, gggadbSNP:375479325
complement(160..162)-, cctdbSNP:149160490
complement(204..206)-, gccdbSNP:200801511
206..207+, ggcggcdbSNP:3830470
complement(242)-c, adbSNP:200827295
complement(251)-g, adbSNP:200798977
complement(305)-g, cdbSNP:367977246
complement(317)-t, cdbSNP:374120801
complement(340)-t, adbSNP:201316886
complement(355)-t, gdbSNP:78590636
359+a, gdbSNP:2271282
complement(369)-g, adbSNP:370941163
complement(398)-g, adbSNP:149393322
complement(401)-g, adbSNP:202180829
complement(402)-g, adbSNP:368009337
complement(430)-t, gdbSNP:374873980
complement(506)-dbSNP:
complement(506)-g, cdbSNP:375975490
complement(515)-c, adbSNP:75732860
complement(517)-t, cdbSNP:200512437
complement(529)-t, cdbSNP:200421130
complement(535)-g, adbSNP:377750035
complement(581)-t, cdbSNP:145081453
complement(599)-g, adbSNP:373182533
complement(611)-t, g, cdbSNP:201253039
complement(621)-g, cdbSNP:141288232
complement(630)-t, cdbSNP:116700192
complement(641)-t, cdbSNP:41300618
complement(654)-t, cdbSNP:201626569
complement(675)-t, cdbSNP:191483051
complement(677)-g, adbSNP:141132978
complement(692)-g, adbSNP:11656602
complement(694)-t, cdbSNP:150997140
complement(782)-dbSNP:
complement(782)-t, cdbSNP:376225936
848+a, cdbSNP:2230312
870+c, gdbSNP:1062597
complement(926)-g, adbSNP:112783387
complement(1010)-t, cdbSNP:61754625
complement(1038)-t, cdbSNP:113503987
complement(1043)-g, adbSNP:373006520
complement(1045)-t, cdbSNP:199660009
complement(1057)-t, cdbSNP:375578952
complement(1082)-g, adbSNP:371081033
complement(1109)-t, cdbSNP:368514878
complement(1112)-t, cdbSNP:201673014
complement(1148)-t, cdbSNP:145562983
complement(1188)-c, adbSNP:376356001
complement(1200)-g, adbSNP:200032909
complement(1292)-g, adbSNP:183168548
complement(1302)-t, adbSNP:144334275
complement(1310)-t, cdbSNP:41306353
complement(1310)-g, adbSNP:386499759
complement(1359)-g, cdbSNP:113119359
complement(1456)-g, adbSNP:143906965
complement(1489)-t, gdbSNP:112108969
complement(1535)-g, cdbSNP:114639799
complement(1569)-g, adbSNP:185757912
complement(1579)-t, cdbSNP:180869035
complement(1687)-c, adbSNP:140010742
complement(1830)-t, cdbSNP:80353801
complement(1944)-g, adbSNP:189181090
complement(2001)-t, cdbSNP:41300620
complement(2039)-c, adbSNP:147489674
complement(2112)-g, adbSNP:374947814
complement(2160)-t, cdbSNP:78170638
complement(2239)-t, adbSNP:114591136
complement(2277..2279)-, aatdbSNP:369259098
complement(2494..2496)-, caadbSNP:369137197
complement(2585)-t, cdbSNP:186345693
complement(2601)-g, adbSNP:181474447
complement(2632)-g, adbSNP:142964967
2899+c, tdbSNP:138727338
complement(2920..2921)-, accccdbSNP:144879210
complement(2934..2937)-, acagdbSNP:376856316
complement(2937..2940)-, cagadbSNP:139410381
complement(2940)-c, adbSNP:190131614
complement(3059)-t, cdbSNP:150259100
complement(3063)-t, adbSNP:116664012
complement(3069)-t, cdbSNP:7342814
complement(3245)-g, adbSNP:75200830
complement(3267)-g, adbSNP:142033484
complement(3323)-t, cdbSNP:184858377
3370+g, tdbSNP:148137657
complement(3505)-t, cdbSNP:116270472
complement(3512)-t, cdbSNP:181465721
complement(3719)-g, adbSNP:372429457
complement(3796)-t, cdbSNP:8076826
complement(3958)-t, gdbSNP:376537020
complement(4133)-t, gdbSNP:189857781
complement(4236)-t, gdbSNP:369015683
complement(4517)-t, cdbSNP:112253470
complement(4542)-g, adbSNP:55927114
complement(4580)-t, cdbSNP:183637284
complement(4617)-t, cdbSNP:374956761
complement(4623)-g, adbSNP:11870431
complement(4631)-g, adbSNP:146686590
complement(4775)-g, adbSNP:375231186
complement(4795)-g, adbSNP:368542859
complement(4799)-g, adbSNP:191493853
complement(4890)-t, cdbSNP:187786929
complement(4947)-t, gdbSNP:367935735
complement(5004)-g, adbSNP:185044336
complement(5014)-g, adbSNP:193087702
complement(5214..5215)-, tdbSNP:372126401
complement(5332)-t, adbSNP:188561776
complement(5417)-c, adbSNP:149021677
5660+g, tdbSNP:144892852
complement(5664)-t, cdbSNP:76790747
complement(5821)-t, cdbSNP:183685578
complement(5898..5902)-, agtagdbSNP:372993120
complement(5901..5902)-tt, agdbSNP:386798385
complement(5931)-t, gdbSNP:149955744
complement(5968)-t, cdbSNP:78234127
complement(5996)-g, adbSNP:139219658
complement(5997)-g, adbSNP:372374534
6043+c, tdbSNP:151190402
complement(6129)-t, cdbSNP:117744809
complement(6246)-g, adbSNP:115295431
complement(6249)-g, adbSNP:56166445
6283+a, gdbSNP:144382215
Gene SymbolGNA13
Gene SynonymG13
Chromosome17
Locus Map17q24.3
Title Mutational and structural analysis of diffuse large B-cell lymphoma using whole-genome sequencing .
Author Morin RD, Mungall K, Pleasance E, Mungall AJ, Goya R, Huff RD, Scott DW, Ding J, Roth A, Chiu R, Corbett RD, Chan FC, Mendez-Lago M, Trinh DL, Bolger-Munro M, Taylor G, Hadj Khodabakhshi A, Ben-Neriah S, Pon J, Meissner B, Woolcock B, Farnoud N, Rogic S, Lim EL, Johnson NA, Shah S, Jones S, Steidl C, Holt R, Birol I, Moore R, Connors JM, Gascoyne RD and Marra MA.
Journal Blood 122 (7), 1256-1265 (2013)
Title The gep proto-oncogene Galpha13 mediates lysophosphatidic acid-mediated migration of pancreatic cancer cells .
Author Gardner JA, Ha JH, Jayaraman M and Dhanasekaran DN.
Journal Pancreas 42 (5), 819-828 (2013)
Title The zinc-binding region of IL-2 inducible T cell kinase (Itk) is required for interaction with Galpha13 and activation of serum response factor .
Author Huang W, Morales JL, Gazivoda VP, Lai J, Qi Q and August A.
Journal Int. J. Biochem. Cell Biol. 45 (6), 1074-1082 (2013)
Title MicroRNA-182 and microRNA-200a control G-protein subunit alpha-13 (GNA13) expression and cell invasion synergistically in prostate cancer cells .
Author Rasheed SA, Teo CR, Beillard EJ, Voorhoeve PM and Casey PJ.
Journal J. Biol. Chem. 288 (11), 7986-7995 (2013)
Title Activation of p115-RhoGEF requires direct association of Galpha13 and the Dbl homology domain .
Author Chen Z, Guo L, Hadas J, Gutowski S, Sprang SR and Sternweis PC.
Journal J. Biol. Chem. 287 (30), 25490-25500 (2012)
Title Galpha12 and galpha13 are phosphorylated during platelet activation .
Author Offermanns S, Hu YH and Simon MI.
Journal J. Biol. Chem. 271 (42), 26044-26048 (1996)
Title The human thyrotropin receptor: a heptahelical receptor capable of stimulating members of all four G protein families .
Author Laugwitz KL, Allgeier A, Offermanns S, Spicher K, Van Sande J, Dumont JE and Schultz G.
Journal Proc. Natl. Acad. Sci. U.S.A. 93 (1), 116-120 (1996)
Title Expression of GTP-binding protein alpha subunits in human thymocytes .
Author Kabouridis PS, Waters ST, Escobar S, Stanners J and Tsoukas CD.
Journal Mol. Cell. Biochem. 144 (1), 45-51 (1995)
Title Mechanism of GTP hydrolysis by G-protein alpha subunits .
Author Kleuss C, Raw AS, Lee E, Sprang SR and Gilman AG.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (21), 9828-9831 (1994)
Title G proteins of the G12 family are activated via thromboxane A2 and thrombin receptors in human platelets .
Author Offermanns S, Laugwitz KL, Spicher K and Schultz G.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (2), 504-508 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.