• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens heat shock 70kDa protein 8 (HSPA8), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_006597 Homo sapiens heat shock 70kDa protein 8 (HSPA8), transcript variant 1, mRNA. ORF Sequence $562.89
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_006597.4, 342349303
Length 2331 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens heat shock 70kDa protein 8 (HSPA8), transcript variant 1, mRNA.
Product heat shock cognate 71 kDa protein isoform 1
Comment

Summary: This gene encodes a member of the heat shock protein 70 family, which contains both heat-inducible and constitutively expressed members. This protein belongs to the latter group, which are also referred to as heat-shock cognate proteins. It functions as a chaperone, and binds to nascent polypeptides to facilitate correct folding. It also functions as an ATPase in the disassembly of clathrin-coated vesicles during transport of membrane components through the cell. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011].


Transcript Variant: This variant (1) represents the predominant transcript, and encodes the longer isoform (1).

RefSeq NP_006588.1
CDS 136..2076
Misc Feature(1)28..30
Misc Feature(2)28..30
Misc Feature(3)136..1971
Misc Feature(4)136..1971
Misc Feature(5)139..141
Misc Feature(6)151..1278
Misc Feature(7)order(163..165,169..180,346..348,574..576,658..660,
Misc Feature(8)order(202..204,208..210,214..216,229..237,241..243,
Misc Feature(9)order(232..234,238..240,304..306,313..318,904..909,
Misc Feature(10)order(589..591,709..711,772..774,778..786,790..795,
Misc Feature(11)592..594
Misc Feature(12)592..594
Misc Feature(13)691..1266
Misc Feature(14)871..873
Misc Feature(15)1090..1092
Misc Feature(16)1219..1221
Misc Feature(17)1564..1566
Misc Feature(18)1900..1902
Misc Feature(19)1924..1926
Misc Feature(20)1936..1938
Exon (1)1..130
Gene:HSPA8
Gene Synonym:HSC54; HSC70; HSC71; HSP71; HSP73; HSPA10; LAP1; NIP71
Exon (2)131..340
Gene:HSPA8
Gene Synonym:HSC54; HSC70; HSC71; HSP71; HSP73; HSPA10; LAP1; NIP71
Exon (3)341..546
Gene:HSPA8
Gene Synonym:HSC54; HSC70; HSC71; HSP71; HSP73; HSPA10; LAP1; NIP71
Exon (4)547..699
Gene:HSPA8
Gene Synonym:HSC54; HSC70; HSC71; HSP71; HSP73; HSPA10; LAP1; NIP71
Exon (5)700..1255
Gene:HSPA8
Gene Synonym:HSC54; HSC70; HSC71; HSP71; HSP73; HSPA10; LAP1; NIP71
Exon (6)1256..1458
Gene:HSPA8
Gene Synonym:HSC54; HSC70; HSC71; HSP71; HSP73; HSPA10; LAP1; NIP71
Exon (7)1459..1657
Gene:HSPA8
Gene Synonym:HSC54; HSC70; HSC71; HSP71; HSP73; HSPA10; LAP1; NIP71
Exon (8)1658..1890
Gene:HSPA8
Gene Synonym:HSC54; HSC70; HSC71; HSP71; HSP73; HSPA10; LAP1; NIP71
Exon (9)1891..2318
Gene:HSPA8
Gene Synonym:HSC54; HSC70; HSC71; HSP71; HSP73; HSPA10; LAP1; NIP71
Translation MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN SLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELE KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(49)-g, cdbSNP:192415561
complement(72)-g, adbSNP:186830244
complement(80)-g, cdbSNP:182109261
complement(83)-t, cdbSNP:190423677
complement(85)-t, cdbSNP:2276077
complement(89)-t, adbSNP:2276076
complement(100)-t, g, adbSNP:2276075
complement(101..102)-t, cdbSNP:11551600
complement(109)-t, adbSNP:187119724
complement(125)-t, cdbSNP:1136141
complement(126)-g, cdbSNP:2276074
complement(177)-g, adbSNP:144123192
complement(229)-t, gdbSNP:11551602
complement(256)-g, adbSNP:75739900
complement(269)-g, adbSNP:201477863
complement(423)-dbSNP:
complement(423)-t, cdbSNP:11551601
complement(432)-g, adbSNP:201223120
complement(451)-g, cdbSNP:200601870
complement(468)-g, cdbSNP:140536048
complement(480)-t, cdbSNP:11551607
complement(481)-c, adbSNP:11551608
complement(502)-g, cdbSNP:11551611
complement(510)-t, cdbSNP:147610984
complement(554)-dbSNP:
complement(554)-t, gdbSNP:141156763
complement(605)-t, cdbSNP:11551603
complement(608)-t, cdbSNP:11551606
complement(621)-t, cdbSNP:145779755
complement(630)-g, adbSNP:141917932
complement(684)-g, adbSNP:148609753
complement(701)-dbSNP:
complement(701)-c, adbSNP:199619043
complement(702)-c, adbSNP:200486073
complement(799)-g, adbSNP:11551599
complement(840)-g, adbSNP:201712472
complement(894)-g, adbSNP:150964023
complement(927)-g, adbSNP:143480238
complement(940)-t, cdbSNP:11551604
complement(949)-t, cdbSNP:11551605
complement(987)-g, adbSNP:148846437
complement(1029)-g, adbSNP:200035932
complement(1050)-g, cdbSNP:145580523
complement(1056)-g, adbSNP:143373443
complement(1122)-t, cdbSNP:139992369
complement(1137)-g, adbSNP:146503730
complement(1140)-g, adbSNP:115882568
complement(1191)-g, adbSNP:139484659
complement(1194)-g, adbSNP:150854686
complement(1209)-t, cdbSNP:142431740
complement(1227)-g, adbSNP:148737498
complement(1309)-dbSNP:
complement(1309)-g, adbSNP:142113865
complement(1335)-g, adbSNP:144361240
complement(1404)-t, cdbSNP:139016926
complement(1510)-dbSNP:
complement(1510)-t, cdbSNP:11551598
complement(1584)-g, adbSNP:199504970
complement(1590)-c, adbSNP:1064585
complement(1614)-t, cdbSNP:138544510
complement(1620)-t, cdbSNP:147529697
complement(1641)-g, adbSNP:111774985
complement(1698)-dbSNP:
complement(1698)-t, cdbSNP:143434494
complement(1725)-t, cdbSNP:137943836
complement(1824)-g, adbSNP:199882006
complement(1827)-g, adbSNP:113013616
complement(1896)-dbSNP:
complement(1896)-g, adbSNP:4802
complement(1914)-t, cdbSNP:112636139
complement(1917)-g, adbSNP:41487746
complement(1930)-g, adbSNP:145240324
complement(1950)-t, gdbSNP:118171965
complement(1959)-g, adbSNP:188408273
complement(2016)-g, adbSNP:201479266
complement(2058)-t, gdbSNP:144785833
complement(2184)-t, gdbSNP:182718582
complement(2250)-c, adbSNP:191052844
complement(2286)-g, adbSNP:4114918
complement(2287)-g, cdbSNP:139624482
complement(2313)-c, adbSNP:3168111
Gene SymbolHSPA8
Gene SynonymHSC54; HSC70; HSC71; HSP71; HSP73; HSPA10; LAP1; NIP71
Chromosome11
Locus Map11q24.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_006597 Homo sapiens heat shock 70kDa protein 8 (HSPA8), transcript variant 1, mRNA. Full Length $675.99
ORF Sequence $562.89
NM_153201 Homo sapiens heat shock 70kDa protein 8 (HSPA8), transcript variant 2, mRNA. Full Length $542.88
ORF Sequence $429.78
Title 70-kDa heat shock cognate protein hsc70 mediates calmodulin-dependent nuclear import of the sex-determining factor .
Author Kaur,G., Lieu,K.G. and Jans,D.A.
Journal J. Biol. Chem. 288 (6), 4148-4157 (2013)
Title A newly uncovered group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity .
Author Cloutier,P., Lavallee-Adam,M., Faubert,D., Blanchette,M. and Coulombe,B.
Journal PLoS Genet. 9 (1), E1003210 (2013)
Title HSP90, HSPA8, HIF-1 alpha and HSP70-2 polymorphisms in breast cancer: a case-control study .
Author Zagouri,F., Sergentanis,T.N., Gazouli,M., Tsigginou,A., Dimitrakakis,C., Papaspyrou,I., Eleutherakis-Papaiakovou,E., Chrysikos,D., Theodoropoulos,G., Zografos,G.C., Antsaklis,A., Dimopoulos,A.M. and Papadimitriou,C.A.
Journal Mol. Biol. Rep. 39 (12), 10873-10879 (2012)
Title Identification of protein interfaces between alpha-synuclein, the principal component of Lewy bodies in Parkinson disease, and the molecular chaperones human Hsc70 and the yeast Ssa1p .
Author Redeker,V., Pemberton,S., Bienvenut,W., Bousset,L. and Melki,R.
Journal J. Biol. Chem. 287 (39), 32630-32639 (2012)
Title The role of chaperone-mediated autophagy in huntingtin degradation .
Author Qi,L., Zhang,X.D., Wu,J.C., Lin,F., Wang,J., DiFiglia,M. and Qin,Z.H.
Journal PLoS ONE 7 (10), E46834 (2012)
Title Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes .
Author Rasmussen,H.H., van Damme,J., Puype,M., Gesser,B., Celis,J.E. and Vandekerckhove,J.
Journal Electrophoresis 13 (12), 960-969 (1992)
Title Intracellular localization and partial amino acid sequence of a stress-inducible 40-kDa protein in HeLa cells .
Author Hattori,H., Liu,Y.C., Tohnai,I., Ueda,M., Kaneda,T., Kobayashi,T., Tanabe,K. and Ohtsuka,K.
Journal Cell Struct. Funct. 17 (1), 77-86 (1992)
Title Uncoating protein (hsc70) binds a conformationally labile domain of clathrin light chain LCa to stimulate ATP hydrolysis .
Author DeLuca-Flaherty,C., McKay,D.B., Parham,P. and Hill,B.L.
Journal Cell 62 (5), 875-887 (1990)
Title The v-rel oncogene product is complexed with cellular proteins including its proto-oncogene product and heat shock protein 70 .
Author Lim,M.Y., Davis,N., Zhang,J.Y. and Bose,H.R. Jr.
Journal Virology 175 (1), 149-160 (1990)
Title Characterization of the thermotolerant cell. II. Effects on the intracellular distribution of heat-shock protein 70, intermediate filaments, and small nuclear ribonucleoprotein complexes .
Author Welch,W.J. and Mizzen,L.A.
Journal J. Cell Biol. 106 (4), 1117-1130 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878