• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens heat shock 70kDa protein 8 (HSPA8), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu27538 Homo sapiens heat shock 70kDa protein 8 (HSPA8), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu27538C Homo sapiens heat shock 70kDa protein 8 (HSPA8), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_006597.5, 527498289
Length 1941 bp
Structure linear
Update Date 26-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens heat shock 70kDa protein 8 (HSPA8), transcript variant 1, mRNA.
Product heat shock cognate 71 kDa protein isoform 1
Comment

Summary: This gene encodes a member of the heat shock protein 70 family, which contains both heat-inducible and constitutively expressed members. This protein belongs to the latter group, which are also referred to as heat-shock cognate proteins. It functions as a chaperone, and binds to nascent polypeptides to facilitate correct folding. It also functions as an ATPase in the disassembly of clathrin-coated vesicles during transport of membrane components through the cell. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011].


Transcript Variant: This variant (1) represents the predominant transcript, and encodes the longer isoform (1).

RefSeq NP_006588.1
CDS 278..2218
Misc Feature(1)170..172
Misc Feature(2)278..2116
Misc Feature(3)278..2116
Misc Feature(4)281..283
Misc Feature(5)293..1420
Misc Feature(6)order(305..307,311..322,488..490,716..718,800..802,
Misc Feature(7)order(344..346,350..352,356..358,371..379,383..385,
Misc Feature(8)order(374..376,380..382,446..448,455..460,1046..1051,
Misc Feature(9)order(731..733,851..853,914..916,920..928,932..937,
Misc Feature(10)734..736
Misc Feature(11)734..736
Misc Feature(12)833..1408
Misc Feature(13)1013..1015
Misc Feature(14)1232..1234
Misc Feature(15)1361..1363
Misc Feature(16)1706..1708
Misc Feature(17)1958..1960
Misc Feature(18)2042..2044
Misc Feature(19)2066..2068
Misc Feature(20)2078..2080
Exon (1)1..272
Gene:HSPA8
Gene Synonym:HEL-33; HEL-S-72p; HSC54; HSC70; HSC71; HSP71; HSP73; HSPA10; LAP-1; LAP1; NIP71
Exon (2)273..482
Gene:HSPA8
Gene Synonym:HEL-33; HEL-S-72p; HSC54; HSC70; HSC71; HSP71; HSP73; HSPA10; LAP-1; LAP1; NIP71
Exon (3)483..688
Gene:HSPA8
Gene Synonym:HEL-33; HEL-S-72p; HSC54; HSC70; HSC71; HSP71; HSP73; HSPA10; LAP-1; LAP1; NIP71
Exon (4)689..841
Gene:HSPA8
Gene Synonym:HEL-33; HEL-S-72p; HSC54; HSC70; HSC71; HSP71; HSP73; HSPA10; LAP-1; LAP1; NIP71
Exon (5)842..1397
Gene:HSPA8
Gene Synonym:HEL-33; HEL-S-72p; HSC54; HSC70; HSC71; HSP71; HSP73; HSPA10; LAP-1; LAP1; NIP71
Exon (6)1398..1600
Gene:HSPA8
Gene Synonym:HEL-33; HEL-S-72p; HSC54; HSC70; HSC71; HSP71; HSP73; HSPA10; LAP-1; LAP1; NIP71
Exon (7)1601..1799
Gene:HSPA8
Gene Synonym:HEL-33; HEL-S-72p; HSC54; HSC70; HSC71; HSP71; HSP73; HSPA10; LAP-1; LAP1; NIP71
Exon (8)1800..2032
Gene:HSPA8
Gene Synonym:HEL-33; HEL-S-72p; HSC54; HSC70; HSC71; HSP71; HSP73; HSPA10; LAP-1; LAP1; NIP71
Exon (9)2033..2460
Gene:HSPA8
Gene Synonym:HEL-33; HEL-S-72p; HSC54; HSC70; HSC71; HSP71; HSP73; HSPA10; LAP-1; LAP1; NIP71
Translation MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN SLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELE KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(6)-dbSNP:
complement(6)-c, adbSNP:185649678
complement(127..128)-, cdbSNP:377729208
complement(128..132)-, tgctgdbSNP:377098901
complement(191)-g, cdbSNP:192415561
complement(214)-g, adbSNP:186830244
complement(222)-g, cdbSNP:182109261
complement(225)-t, cdbSNP:190423677
complement(227)-t, cdbSNP:2276077
complement(231)-t, adbSNP:2276076
complement(242)-t, g, adbSNP:2276075
243..244+c, tdbSNP:11551600
complement(251)-t, adbSNP:187119724
267+c, tdbSNP:1136141
complement(268)-g, cdbSNP:2276074
complement(319)-g, adbSNP:144123192
371+g, tdbSNP:11551602
complement(398)-g, adbSNP:75739900
complement(403)-g, cdbSNP:369851462
complement(411)-g, adbSNP:201477863
complement(430)-g, adbSNP:376156706
565+dbSNP:
565+c, tdbSNP:11551601
complement(574)-g, adbSNP:201223120
complement(593)-g, cdbSNP:200601870
complement(598)-g, adbSNP:371835507
complement(610)-g, c, adbSNP:140536048
complement(652)-t, cdbSNP:147610984
complement(655)-t, cdbSNP:374961418
complement(696)-dbSNP:
complement(696)-t, gdbSNP:141156763
complement(763)-t, cdbSNP:145779755
complement(772)-g, adbSNP:141917932
complement(826)-g, adbSNP:148609753
complement(843)-dbSNP:
complement(843)-c, adbSNP:199619043
complement(844)-c, adbSNP:200486073
complement(874)-g, adbSNP:376403473
941+a, gdbSNP:11551599
complement(982)-g, adbSNP:201712472
complement(985)-t, cdbSNP:373526651
complement(1033)-g, adbSNP:369763812
complement(1036)-g, adbSNP:150964023
complement(1069)-g, adbSNP:143480238
1082+c, tdbSNP:11551604
1091+c, tdbSNP:11551605
complement(1129)-g, adbSNP:148846437
complement(1171)-g, adbSNP:200035932
complement(1192)-g, cdbSNP:145580523
complement(1198)-g, adbSNP:143373443
complement(1258)-g, adbSNP:376828215
complement(1264)-t, cdbSNP:139992369
complement(1266)-t, adbSNP:373235233
complement(1279)-g, adbSNP:146503730
complement(1282)-g, adbSNP:115882568
complement(1333)-g, adbSNP:139484659
complement(1336)-g, adbSNP:150854686
complement(1351)-t, cdbSNP:142431740
complement(1369)-g, adbSNP:148737498
complement(1451)-dbSNP:
complement(1451)-g, adbSNP:142113865
complement(1477)-g, adbSNP:144361240
complement(1502)-t, cdbSNP:372928718
complement(1513)-g, adbSNP:371408292
complement(1534)-g, adbSNP:368207632
complement(1546)-t, cdbSNP:139016926
complement(1645)-dbSNP:
complement(1645)-t, adbSNP:377257990
complement(1652)-t, cdbSNP:386519083
1652+c, tdbSNP:11551598
complement(1726)-g, adbSNP:199504970
1732+a, cdbSNP:1064585
complement(1756)-t, cdbSNP:138544510
complement(1762)-t, cdbSNP:147529697
complement(1783)-g, adbSNP:111774985
complement(1840)-dbSNP:
complement(1840)-t, cdbSNP:143434494
complement(1849)-t, cdbSNP:371945853
complement(1867)-t, cdbSNP:137943836
complement(1966)-g, adbSNP:199882006
complement(1969)-g, adbSNP:113013616
complement(2038)-dbSNP:
complement(2038)-g, adbSNP:4802
complement(2056)-t, cdbSNP:112636139
complement(2059)-g, adbSNP:41487746
complement(2072)-g, adbSNP:145240324
complement(2089)-g, adbSNP:370796977
complement(2091)-g, adbSNP:377681653
complement(2092)-t, gdbSNP:118171965
complement(2101)-g, adbSNP:188408273
complement(2158)-g, adbSNP:201479266
complement(2200)-t, gdbSNP:144785833
complement(2212)-t, adbSNP:373523144
complement(2253)-t, cdbSNP:370664775
complement(2288..2289)-, tdbSNP:372684210
complement(2326)-t, gdbSNP:182718582
complement(2392)-c, adbSNP:191052844
complement(2428)-g, adbSNP:4114918
complement(2429)-g, cdbSNP:139624482
2455+a, cdbSNP:3168111
Gene SymbolHSPA8
Gene SynonymHEL-33; HEL-S-72p; HSC54; HSC70; HSC71; HSP71; HSP73; HSPA10; LAP-1; LAP1; NIP71
Chromosome11
Locus Map11q24.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_153201 Homo sapiens heat shock 70kDa protein 8 (HSPA8), transcript variant 2, mRNA. On-demand $219.00 7-9
NM_006597 Homo sapiens heat shock 70kDa protein 8 (HSPA8), transcript variant 1, mRNA. In-stock $99.00 5-7
XM_006718831 PREDICTED: Homo sapiens heat shock 70kDa protein 8 (HSPA8), transcript variant X1, mRNA. On-demand $219.00 7-9
Title HSP70 polymorphisms in first psychotic episode drug-naive schizophrenic patients .
Author Bozidis P, Hyphantis T, Mantas C, Sotiropoulou M, Antypa N, Andreoulakis E, Serretti A, Mavreas V and Antoniou K.
Journal Life Sci. 100 (2), 133-137 (2014)
Title The molecular chaperone Hsp70 activates protein phosphatase 5 (PP5) by binding the tetratricopeptide repeat (TPR) domain .
Author Connarn JN, Assimon VA, Reed RA, Tse E, Southworth DR, Zuiderweg ER, Gestwicki JE and Sun D.
Journal J. Biol. Chem. 289 (5), 2908-2917 (2014)
Title Endoplasmic reticulum protein quality control is determined by cooperative interactions between Hsp/c70 protein and the CHIP E3 ligase .
Author Matsumura Y, Sakai J and Skach WR.
Journal J. Biol. Chem. 288 (43), 31069-31079 (2013)
Title STUB1/CHIP is required for HIF1A degradation by chaperone-mediated autophagy .
Author Ferreira JV, Fofo H, Bejarano E, Bento CF, Ramalho JS, Girao H and Pereira P.
Journal Autophagy 9 (9), 1349-1366 (2013)
Title Connexin43 functions as a novel interacting partner of heat shock cognate protein 70 .
Author Hatakeyama T, Dai P, Harada Y, Hino H, Tsukahara F, Maru Y, Otsuji
Journal Sci Rep 3, 2719 (2013)
Title Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes .
Author Rasmussen HH, van Damme J, Puype M, Gesser B, Celis JE and Vandekerckhove J.
Journal Electrophoresis 13 (12), 960-969 (1992)
Title Intracellular localization and partial amino acid sequence of a stress-inducible 40-kDa protein in HeLa cells .
Author Hattori H, Liu YC, Tohnai I, Ueda M, Kaneda T, Kobayashi T, Tanabe
Journal Cell Struct. Funct. 17 (1), 77-86 (1992)
Title Uncoating protein (hsc70) binds a conformationally labile domain of clathrin light chain LCa to stimulate ATP hydrolysis .
Author DeLuca-Flaherty C, McKay DB, Parham P and Hill BL.
Journal Cell 62 (5), 875-887 (1990)
Title The v-rel oncogene product is complexed with cellular proteins including its proto-oncogene product and heat shock protein 70 .
Author Lim MY, Davis N, Zhang JY and Bose HR Jr.
Journal Virology 175 (1), 149-160 (1990)
Title Characterization of the thermotolerant cell. II. Effects on the intracellular distribution of heat-shock protein 70, intermediate filaments, and small nuclear ribonucleoprotein complexes .
Author Welch WJ and Mizzen LA.
Journal J. Cell Biol. 106 (4), 1117-1130 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.