• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_006642 Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_006642.3, 308210778
Length 2632 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), mRNA.
Product serologically defined colon cancer antigen 8
Comment

Summary: This gene encodes a centrosome associated protein. This protein may be involved in organizing the centrosome during interphase and mitosis. Mutations in this gene are associated with retinal-renal ciliopathy. [provided by RefSeq, Oct 2010].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_006633.1
CDS 170..2311
Misc Feature(1)158..160
Misc Feature(2)<542..1726
Misc Feature(3)<542..1726
Misc Feature(4)815..2308
Misc Feature(5)1172..>2284
Misc Feature(6)1766..2308
Exon (1)1..236
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (2)237..389
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (3)390..475
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (4)476..589
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (5)590..715
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (6)716..844
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (7)845..909
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (8)910..1098
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (9)1099..1237
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (10)1238..1390
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (11)1391..1525
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (12)1526..1642
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (13)1643..1785
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (14)1786..1913
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (15)1914..2022
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (16)2023..2154
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (17)2155..2281
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (18)2282..2617
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Translation MAKSPENSTLEEILGQYQRSLREHASRSIHQLTCALKEGDVTIGEDAPNLSFSTSVGNED ARTAWPELQQSHAVNQLKDLLRQQADKESEVSPSRRRKMSPLRSLEHEETNMPTMHDLVH TINDQSQYIHHLEAEVKFCKEELSGMKNKIQVVVLENEGLQQQLKSQRQEETLREQTLLD ASGNMHNSWITTGEDSGVGETSKRPFSHDNADFGKAASAGEQLELEKLKLTYEEKCEIEE SQLKFLRNDLAEYQRTCEDLKEQLKHKEFLLAANTCNRVGGLCLKCAQHEAVLSQTHTNV HMQTIERLVKERDDLMSALVSVRSSLADTQQREASAYEQVKQVLQISEEANFEKTKALIQ CDQLRKELERQAERLEKELASQQEKRAIEKDMMKKEITKEREYMGSKMLILSQNIAQLEA QVEKVTKEKISAINQLEEIQSQLASREMDVTKVCGEMRYQLNKTNMEKDEAEKEHREFRA KTNRDLEIKDQEIEKLRIELDESKQHLEQEQQKAALAREECLRLTELLGESEHQLHLTRQ EKDSIQQSFSKEAKAQALQAQQREQELTQKIQQMEAQHDKTENEQYLLLTSQNTFLTKLK EECCTLAKKLEQISQKTRSEIAQLSQEKRYTYDKLGKLQRRNEELEEQCVQHGRVHETMK QRLRQLDKHSQATAQQLVQLLSKQNQLLLERQSLSEEVDRLRTQLPSMPQSDC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
62..63+dbSNP:
62..63+, gdbSNP:35774958
85+c, tdbSNP:187268286
88+c, gdbSNP:370997991
109+a, gdbSNP:368656599
complement(123)-t, adbSNP:3904682
126+a, cdbSNP:376221876
128+a, gdbSNP:374979999
129+c, tdbSNP:369401351
166+a, gdbSNP:113193158
268+dbSNP:
268+a, gdbSNP:150953430
287+a, gdbSNP:202114636
343+a, tdbSNP:368801248
349+c, tdbSNP:377358593
350+c, g, tdbSNP:149928402
367+c, tdbSNP:201715098
376+a, gdbSNP:200994363
381..382+, cdbSNP:35464722
406+dbSNP:
406+a, tdbSNP:146474568
413+c, tdbSNP:143447584
419+a, cdbSNP:201658593
436+c, tdbSNP:148818431
447+c, tdbSNP:140413256
448+a, gdbSNP:145877279
452+a, gdbSNP:377564587
466+a, gdbSNP:193291617
471+c, tdbSNP:371182563
517+dbSNP:
517+c, tdbSNP:143226730
519+a, cdbSNP:149561407
533+a, gdbSNP:377473337
596+dbSNP:
596+c, gdbSNP:371179612
623+a, gdbSNP:374580113
641+a, gdbSNP:367590060
649+c, tdbSNP:371348715
686+c, tdbSNP:373877739
690+a, gdbSNP:368200875
711+c, tdbSNP:372403021
712+a, cdbSNP:375641930
726+dbSNP:
726+a, gdbSNP:144254594
729+a, gdbSNP:185077992
741+c, tdbSNP:150070966
766+c, tdbSNP:143407309
830+a, gdbSNP:373999051
848+dbSNP:
848+a, tdbSNP:267607031
898+a, gdbSNP:199629519
913+dbSNP:
913+c, tdbSNP:138449445
947+c, gdbSNP:201869920
953+c, gdbSNP:149038104
967+c, tdbSNP:74586093
1002+a, gdbSNP:200657425
1035+a, gdbSNP:147807589
1036+c, tdbSNP:376682074
1081+c, tdbSNP:976529
1082+a, gdbSNP:200447734
1084+c, tdbSNP:371251483
1094+a, gdbSNP:149359674
1110+dbSNP:
1110+a, gdbSNP:111775515
1113+c, tdbSNP:200294385
1116+c, tdbSNP:200461035
1119+c, tdbSNP:368258515
1124+c, tdbSNP:372404255
1133+a, gdbSNP:6672843
1155+c, tdbSNP:35859404
1165+a, gdbSNP:142658750
1191+a, cdbSNP:145984257
1233+a, cdbSNP:199524638
1240+dbSNP:
1240+c, tdbSNP:144234264
1263+a, gdbSNP:115098969
1284+c, g, tdbSNP:74701277
complement(1287)-g, adbSNP:74579482
complement(1303)-t, adbSNP:2275155
1327+c, gdbSNP:200987365
1332+a, tdbSNP:377237088
1346+a, gdbSNP:199609539
1362+c, tdbSNP:79435766
1442+dbSNP:
1442+a, gdbSNP:370072966
1445+a, gdbSNP:201580075
1448+a, cdbSNP:375037219
1461+c, tdbSNP:143386133
1508..1509+, gdbSNP:387906218
1549+dbSNP:
1549+c, gdbSNP:79762798
1578+a, gdbSNP:118064970
1589+, gdbSNP:397515335
1592+c, tdbSNP:190941099
1670+dbSNP:
1670+c, gdbSNP:150646039
1694+c, gdbSNP:199919586
1705+g, tdbSNP:372453555
1712+a, gdbSNP:200767475
1713+a, cdbSNP:201446416
1714+a, cdbSNP:200048002
1720+c, gdbSNP:144122242
1756+c, tdbSNP:144194469
1757+a, gdbSNP:190020173
1771+a, gdbSNP:376069580
1782+c, gdbSNP:370441955
1894+dbSNP:
1894+a, gdbSNP:10927011
1919+dbSNP:
1919+a, gdbSNP:150961792
1930+a, gdbSNP:149837444
1959+a, cdbSNP:372641187
2025+dbSNP:
2025+a, cdbSNP:145896729
2057+c, tdbSNP:138187640
2091..2092+, adbSNP:34075794
2102+a, tdbSNP:181033600
2104+a, gdbSNP:185944691
2111+c, tdbSNP:367572249
2114+c, tdbSNP:371805116
2115..2118+, gtgtdbSNP:397515336
2145+c, tdbSNP:375244541
2147+a, cdbSNP:141230462
2200+dbSNP:
2200+a, gdbSNP:201112344
2236+a, gdbSNP:191821211
2249+c, tdbSNP:375013516
2267+a, cdbSNP:369591883
2273+c, tdbSNP:182859748
2277+c, tdbSNP:368583241
2289+dbSNP:
2289+a, gdbSNP:368277791
2313+c, tdbSNP:376082705
2346+a, gdbSNP:370202653
2362+c, tdbSNP:373195978
2372..2373+, gacttdbSNP:368945100
2390+c, tdbSNP:369079480
2436+a, gdbSNP:372086684
2452+a, gdbSNP:369944084
2521+, gdbSNP:3831932
2609+c, tdbSNP:182270139
Gene SymbolSDCCAG8
Gene SynonymBBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Chromosome1
Locus Map1q43
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006642 Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), mRNA. On-demand $849.00 20
XM_006711727 PREDICTED: Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), transcript variant X14, mRNA. On-demand $849.00 20
XM_006711728 PREDICTED: Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), transcript variant X15, mRNA. On-demand $849.00 20
XM_005273013 PREDICTED: Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), transcript variant X3, mRNA. On-demand $849.00 20
XM_006711729 PREDICTED: Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), transcript variant X16, mRNA. On-demand $849.00 20
XM_005273016 PREDICTED: Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), transcript variant X6, mRNA. On-demand $849.00 20
XM_005273018 PREDICTED: Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), transcript variant X8, mRNA. On-demand $849.00 20
XM_005273021 PREDICTED: Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), transcript variant X11, mRNA. On-demand $549.00 14
XM_005273022 PREDICTED: Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), transcript variant X12, mRNA. On-demand $549.00 14
XM_006711730 PREDICTED: Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), transcript variant X17, mRNA. On-demand $549.00 14
XM_005273023 PREDICTED: Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), transcript variant X13, mRNA. On-demand $549.00 14
XM_006724964 PREDICTED: Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), transcript variant X1, mRNA. On-demand $849.00 20
XM_006724965 PREDICTED: Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), transcript variant X2, mRNA. On-demand $849.00 20
XM_006724966 PREDICTED: Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), transcript variant X3, mRNA. On-demand $849.00 20
XM_006724967 PREDICTED: Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), transcript variant X4, mRNA. On-demand $849.00 20
XM_006724968 PREDICTED: Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), transcript variant X5, mRNA. On-demand $849.00 20
XM_006724969 PREDICTED: Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), transcript variant X6, mRNA. On-demand $849.00 20
XM_006724970 PREDICTED: Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), transcript variant X7, mRNA. On-demand $549.00 14
XM_006724971 PREDICTED: Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), transcript variant X8, mRNA. On-demand $549.00 14
XM_006724972 PREDICTED: Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), transcript variant X9, mRNA. On-demand $549.00 14
XM_006724973 PREDICTED: Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), transcript variant X10, mRNA. On-demand $549.00 14
Title Genome-wide association analysis identifies 13 new risk loci for schizophrenia .
Author Ripke S, O'Dushlaine C, Chambert K, Moran JL, Kahler AK, Akterin S, Bergen SE, Collins AL, Crowley JJ, Fromer M, Kim Y, Lee SH, Magnusson PK, Sanchez N, Stahl EA, Williams S, Wray NR, Xia K, Bettella F, Borglum AD, Bulik-Sullivan BK, Cormican P, Craddock N, de Leeuw C, Durmishi N, Gill M, Golimbet V, Hamshere ML, Holmans P, Hougaard DM, Kendler KS, Lin K, Morris DW, Mors O, Mortensen PB, Neale BM, O'Neill FA, Owen MJ, Milovancevic MP, Posthuma D, Powell J, Richards AL, Riley BP, Ruderfer D, Rujescu D, Sigurdsson E, Silagadze T, Smit AB, Stefansson H, Steinberg S, Suvisaari J, Tosato S, Verhage M, Walters JT, Levinson DF, Gejman PV, Kendler KS, Laurent C, Mowry BJ, O'Donovan MC, Owen MJ, Pulver AE, Riley BP, Schwab SG, Wildenauer DB, Dudbridge F, Holmans P, Shi J, Albus M, Alexander M, Campion D, Cohen D, Dikeos D, Duan J, Eichhammer P, Godard S, Hansen M, Lerer FB, Liang KY, Maier W, Mallet J, Nertney DA, Nestadt G, Norton N, O'Neill FA, Papadimitriou GN, Ribble R, Sanders AR, Silverman JM, Walsh D, Williams NM, Wormley B, Arranz MJ, Bakker S, Bender S, Bramon E, Collier D, Crespo-Facorro B, Hall J, Iyegbe C, Jablensky A, Kahn RS, Kalaydjieva L, Lawrie S, Lewis CM, Lin K, Linszen DH, Mata I, McIntosh A, Murray RM, Ophoff RA, Powell J, Rujescu D, Van Os J, Walshe M, Weisbrod M, Wiersma D, Donnelly P, Barroso I, Blackwell JM, Bramon E, Brown MA, Casas JP, Corvin AP, Deloukas P, Duncanson A, Jankowski J, Markus HS, Mathew CG, Palmer CN, Plomin R, Rautanen A, Sawcer SJ, Trembath RC, Viswanathan AC, Wood NW, Spencer CC, Band G, Bellenguez C, Freeman C, Hellenthal G, Giannoulatou E, Pirinen M, Pearson RD, Strange A, Su Z, Vukcevic D, Donnelly P, Langford C, Hunt SE, Edkins S, Gwilliam R, Blackburn H, Bumpstead SJ, Dronov S, Gillman M, Gray E, Hammond N, Jayakumar A, McCann OT, Liddle J, Potter SC, Ravindrarajah R, Ricketts M, Tashakkori-Ghanbaria A, Waller MJ, Weston P, Widaa S, Whittaker P, Barroso I, Deloukas P, Mathew CG, Blackwell JM, Brown MA, Corvin AP, McCarthy MI, Spencer CC, Bramon E, Corvin AP, O'Donovan MC, Stefansson K, Scolnick E, Purcell S, McCarroll SA, Sklar P, Hultman CM and Sullivan PF.
Journal Nat. Genet. 45 (10), 1150-1159 (2013)
Title Genome-wide significant associations in schizophrenia to ITIH3/4, CACNA1C and SDCCAG8, and extensive replication of associations reported by the Schizophrenia PGC .
Author Hamshere ML, Walters JT, Smith R, Richards AL, Green E, Grozeva D, Jones I, Forty L, Jones L, Gordon-Smith K, Riley B, O'Neill FA, Kendler KS, Sklar P, Purcell S, Kranz J, Morris D, Gill M, Holmans P, Craddock N, Corvin A, Owen MJ and O'Donovan MC.
Journal Mol. Psychiatry 18 (6), 708-712 (2013)
Title GWAS meta analysis identifies TSNARE1 as a novel Schizophrenia / Bipolar susceptibility locus .
Author Sleiman P, Wang D, Glessner J, Hadley D, Gur RE, Cohen N, Li Q and Hakonarson H.
Journal Sci Rep 3, 3075 (2013)
Title Mutational analysis of SDCCAG8 in Bardet-Biedl syndrome patients with renal involvement and absent polydactyly .
Author Billingsley G, Vincent A, Deveault C and Heon E.
Journal Ophthalmic Genet. 33 (3), 150-154 (2012)
Title Candidate exome capture identifies mutation of SDCCAG8 as the cause of a retinal-renal ciliopathy .
Author Otto EA, Hurd TW, Airik R, Chaki M, Zhou W, Stoetzel C, Patil SB, Levy S, Ghosh AK, Murga-Zamalloa CA, van Reeuwijk J, Letteboer SJ, Sang L, Giles RH, Liu Q, Coene KL, Estrada-Cuzcano A, Collin RW, McLaughlin HM, Held S, Kasanuki JM, Ramaswami G, Conte J, Lopez I, Washburn J, Macdonald J, Hu J, Yamashita Y, Maher ER, Guay-Woodford LM, Neumann HP, Obermuller N, Koenekoop RK, Bergmann C, Bei X, Lewis RA, Katsanis N, Lopes V, Williams DS, Lyons RH, Dang CV, Brito DA, Dias MB, Zhang X, Cavalcoli JD, Nurnberg G, Nurnberg P, Pierce EA, Jackson PK, Antignac C, Saunier S, Roepman R, Dollfus H, Khanna H and Hildebrandt F.
Journal Nat. Genet. 42 (10), 840-850 (2010)
Title Two new Loci for body-weight regulation identified in a joint analysis of genome-wide association studies for early-onset extreme obesity in French and german study groups .
Author Scherag A, Dina C, Hinney A, Vatin V, Scherag S, Vogel CI, Muller TD, Grallert H, Wichmann HE, Balkau B, Heude B, Jarvelin MR, Hartikainen AL, Levy-Marchal C, Weill J, Delplanque J, Korner A, Kiess W, Kovacs P, Rayner NW, Prokopenko I, McCarthy MI, Schafer H, Jarick I, Boeing H, Fisher E, Reinehr T, Heinrich J, Rzehak P, Berdel D, Borte M, Biebermann H, Krude H, Rosskopf D, Rimmbach C, Rief W, Fromme T, Klingenspor M, Schurmann A, Schulz N, Nothen MM, Muhleisen TW, Erbel R, Jockel KH, Moebus S, Boes T, Illig T, Froguel P, Hebebrand J and Meyre D.
Journal PLoS Genet. 6 (4), E1000916 (2010)
Title Follow-up examination of linkage and association to chromosome 1q43 in multiple sclerosis .
Author McCauley JL, Zuvich RL, Bradford Y, Kenealy SJ, Schnetz-Boutaud N, Gregory SG, Hauser SL, Oksenberg JR, Mortlock DP, Pericak-Vance MA and Haines JL.
Journal Genes Immun. 10 (7), 624-630 (2009)
Title Identification and characterization of the novel centrosome-associated protein CCCAP .
Author Kenedy AA, Cohen KJ, Loveys DA, Kato GJ and Dang CV.
Journal Gene 303, 35-46 (2003)
Title Characterization of human colon cancer antigens recognized by autologous antibodies .
Author Scanlan MJ, Chen YT, Williamson B, Gure AO, Stockert E, Gordan JD, Tureci O, Sahin U, Pfreundschuh M and Old LJ.
Journal Int. J. Cancer 76 (5), 652-658 (1998)
Title Bardet-Biedl Syndrome .
Author Forsythe,E. and Beales,P.L.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.