• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), mRNA.


RefSeq Accession Definition Services Price Order
NM_006642 Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), mRNA. ORF Sequence $621.18
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_006642.3, 308210778
Length 2632 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), mRNA.
Product serologically defined colon cancer antigen 8
Comment

Summary: This gene encodes a centrosome associated protein. This protein may be involved in organizing the centrosome during interphase and mitosis. Mutations in this gene are associated with retinal-renal ciliopathy. [provided by RefSeq, Oct 2010].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.


##Evidence-Data-START## Transcript exon combination :: AK299212.1, AF250731.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_006633.1
CDS 170..2311
Misc Feature(1)158..160
Misc Feature(2)815..2308
Misc Feature(3)815..2308
Misc Feature(4)<1076..2221
Misc Feature(5)1766..2308
Exon (1)1..236
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (2)237..389
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (3)390..475
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (4)476..589
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (5)590..715
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (6)716..844
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (7)845..909
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (8)910..1098
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (9)1099..1237
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (10)1238..1390
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (11)1391..1525
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (12)1526..1642
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (13)1643..1785
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (14)1786..1913
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (15)1914..2022
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (16)2023..2154
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (17)2155..2281
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Exon (18)2282..2617
Gene:SDCCAG8
Gene Synonym:BBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Translation MAKSPENSTLEEILGQYQRSLREHASRSIHQLTCALKEGDVTIGEDAPNLSFSTSVGNED ARTAWPELQQSHAVNQLKDLLRQQADKESEVSPSRRRKMSPLRSLEHEETNMPTMHDLVH TINDQSQYIHHLEAEVKFCKEELSGMKNKIQVVVLENEGLQQQLKSQRQEETLREQTLLD ASGNMHNSWITTGEDSGVGETSKRPFSHDNADFGKAASAGEQLELEKLKLTYEEKCEIEE SQLKFLRNDLAEYQRTCEDLKEQLKHKEFLLAANTCNRVGGLCLKCAQHEAVLSQTHTNV HMQTIERLVKERDDLMSALVSVRSSLADTQQREASAYEQVKQVLQISEEANFEKTKALIQ CDQLRKELERQAERLEKELASQQEKRAIEKDMMKKEITKEREYMGSKMLILSQNIAQLEA QVEKVTKEKISAINQLEEIQSQLASREMDVTKVCGEMRYQLNKTNMEKDEAEKEHREFRA KTNRDLEIKDQEIEKLRIELDESKQHLEQEQQKAALAREECLRLTELLGESEHQLHLTRQ EKDSIQQSFSKEAKAQALQAQQREQELTQKIQQMEAQHDKTENEQYLLLTSQNTFLTKLK EECCTLAKKLEQISQKTRSEIAQLSQEKRYTYDKLGKLQRRNEELEEQCVQHGRVHETMK QRLRQLDKHSQATAQQLVQLLSKQNQLLLERQSLSEEVDRLRTQLPSMPQSDC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
61..62+dbSNP:
61..62+, gdbSNP:35774958
85+c, tdbSNP:187268286
123+a, tdbSNP:3904682
166+a, gdbSNP:113193158
268+dbSNP:
268+a, gdbSNP:150953430
287+a, gdbSNP:202114636
350+c, g, tdbSNP:149928402
367+c, tdbSNP:201715098
376+a, gdbSNP:200994363
381..382+, cdbSNP:35464722
406+dbSNP:
406+a, tdbSNP:146474568
413+c, tdbSNP:143447584
419+a, cdbSNP:201658593
436+c, tdbSNP:148818431
447+c, tdbSNP:140413256
448+a, gdbSNP:145877279
466+a, gdbSNP:193291617
517+dbSNP:
517+c, tdbSNP:143226730
519+a, cdbSNP:149561407
726+dbSNP:
726+a, gdbSNP:144254594
729+a, gdbSNP:185077992
741+c, tdbSNP:150070966
766+c, tdbSNP:143407309
848+dbSNP:
848+a, tdbSNP:267607031
851+c, gdbSNP:139220760
898+a, gdbSNP:199629519
913+dbSNP:
913+c, tdbSNP:138449445
947+c, gdbSNP:201869920
953+c, gdbSNP:149038104
967+c, tdbSNP:74586093
1002+a, gdbSNP:200657425
1035+a, gdbSNP:147807589
1081+c, tdbSNP:976529
1082+a, gdbSNP:200447734
1088+a, gdbSNP:150272080
1094+a, gdbSNP:149359674
1110+dbSNP:
1110+a, gdbSNP:111775515
1113+c, tdbSNP:200294385
1116+c, tdbSNP:200461035
1133+a, gdbSNP:6672843
1155+c, tdbSNP:35859404
1165+a, gdbSNP:142658750
1191+a, cdbSNP:145984257
1233+a, cdbSNP:199524638
1240+dbSNP:
1240+c, tdbSNP:144234264
1263+a, gdbSNP:115098969
1284+c, g, tdbSNP:74701277
1287+a, gdbSNP:74579482
1303+a, tdbSNP:2275155
1327+c, gdbSNP:200987365
1346+a, gdbSNP:199609539
1362+c, tdbSNP:79435766
1445+dbSNP:
1445+a, gdbSNP:201580075
1461+c, tdbSNP:143386133
1549+dbSNP:
1549+c, gdbSNP:79762798
1578+a, gdbSNP:118064970
1592+c, tdbSNP:190941099
1670+dbSNP:
1670+c, gdbSNP:150646039
1694+c, gdbSNP:199919586
1712+a, gdbSNP:200767475
1713+a, cdbSNP:201446416
1714+a, cdbSNP:200048002
1720+c, gdbSNP:144122242
1756+c, tdbSNP:144194469
1757+a, gdbSNP:190020173
1894+dbSNP:
1894+a, gdbSNP:10927011
1919+dbSNP:
1919+a, gdbSNP:150961792
1930+a, gdbSNP:149837444
2025+dbSNP:
2025+a, cdbSNP:145896729
2057+c, tdbSNP:138187640
2089..2090+, adbSNP:34075794
2102+a, tdbSNP:181033600
2104+a, gdbSNP:185944691
2147+a, cdbSNP:141230462
2200+dbSNP:
2200+a, gdbSNP:201112344
2236+a, gdbSNP:191821211
2273+c, tdbSNP:182859748
2340+dbSNP:
2340+, tdbSNP:67228538
2521+, gdbSNP:3831932
2609+c, tdbSNP:182270139
Gene SymbolSDCCAG8
Gene SynonymBBS16; CCCAP; CCCAP SLSN7; hCCCAP; HSPC085; NPHP10; NY-CO-8; SLSN7
Chromosome1
Locus Map1q43
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_006642 Homo sapiens serologically defined colon cancer antigen 8 (SDCCAG8), mRNA. Full Length $763.28
ORF Sequence $621.18
Title Mutational analysis of SDCCAG8 in Bardet-Biedl syndrome patients with renal involvement and absent polydactyly .
Author Billingsley,G., Vincent,A., Deveault,C. and Heon,E.
Journal Ophthalmic Genet. 33 (3), 150-154 (2012)
Title SDCCAG8 obesity alleles and reduced weight loss after a lifestyle intervention in overweight children and adolescents .
Author Scherag,A., Kleber,M., Boes,T., Kolbe,A.L., Ruth,A., Grallert,H., Illig,T., Heid,I.M., Toschke,A.M., Grau,K., Sorensen,T.I., Hebebrand,J., Hinney,A. and Reinehr,T.
Journal Obesity (Silver Spring) 20 (2), 466-470 (2012)
Title Genome-wide association study identifies five new schizophrenia loci .
Author
Journal Nat. Genet. 43 (10), 969-976 (2011)
Title Candidate exome capture identifies mutation of SDCCAG8 as the cause of a retinal-renal ciliopathy .
Author Otto,E.A., Hurd,T.W., Airik,R., Chaki,M., Zhou,W., Stoetzel,C., Patil,S.B., Levy,S., Ghosh,A.K., Murga-Zamalloa,C.A., van Reeuwijk,J., Letteboer,S.J., Sang,L., Giles,R.H., Liu,Q., Coene,K.L., Estrada-Cuzcano,A., Collin,R.W., McLaughlin,H.M., Held,S., Kasanuki,J.M., Ramaswami,G., Conte,J., Lopez,I., Washburn,J., Macdonald,J., Hu,J., Yamashita,Y., Maher,E.R., Guay-Woodford,L.M., Neumann,H.P., Obermuller,N., Koenekoop,R.K., Bergmann,C., Bei,X., Lewis,R.A., Katsanis,N., Lopes,V., Williams,D.S., Lyons,R.H., Dang,C.V., Brito,D.A., Dias,M.B., Zhang,X., Cavalcoli,J.D., Nurnberg,G., Nurnberg,P., Pierce,E.A., Jackson,P.K., Antignac,C., Saunier,S., Roepman,R., Dollfus,H., Khanna,H. and Hildebrandt,F.
Journal Nat. Genet. 42 (10), 840-850 (2010)
Title Two new Loci for body-weight regulation identified in a joint analysis of genome-wide association studies for early-onset extreme obesity in French and german study groups .
Author Scherag,A., Dina,C., Hinney,A., Vatin,V., Scherag,S., Vogel,C.I., Muller,T.D., Grallert,H., Wichmann,H.E., Balkau,B., Heude,B., Jarvelin,M.R., Hartikainen,A.L., Levy-Marchal,C., Weill,J., Delplanque,J., Korner,A., Kiess,W., Kovacs,P., Rayner,N.W., Prokopenko,I., McCarthy,M.I., Schafer,H., Jarick,I., Boeing,H., Fisher,E., Reinehr,T., Heinrich,J., Rzehak,P., Berdel,D., Borte,M., Biebermann,H., Krude,H., Rosskopf,D., Rimmbach,C., Rief,W., Fromme,T., Klingenspor,M., Schurmann,A., Schulz,N., Nothen,M.M., Muhleisen,T.W., Erbel,R., Jockel,K.H., Moebus,S., Boes,T., Illig,T., Froguel,P., Hebebrand,J. and Meyre,D.
Journal PLoS Genet. 6 (4), E1000916 (2010)
Title Follow-up examination of linkage and association to chromosome 1q43 in multiple sclerosis .
Author McCauley,J.L., Zuvich,R.L., Bradford,Y., Kenealy,S.J., Schnetz-Boutaud,N., Gregory,S.G., Hauser,S.L., Oksenberg,J.R., Mortlock,D.P., Pericak-Vance,M.A. and Haines,J.L.
Journal Genes Immun. 10 (7), 624-630 (2009)
Title Identification and characterization of the novel centrosome-associated protein CCCAP .
Author Kenedy,A.A., Cohen,K.J., Loveys,D.A., Kato,G.J. and Dang,C.V.
Journal Gene 303, 35-46 (2003)
Title Characterization of human colon cancer antigens recognized by autologous antibodies .
Author Scanlan,M.J., Chen,Y.T., Williamson,B., Gure,A.O., Stockert,E., Gordan,J.D., Tureci,O., Sahin,U., Pfreundschuh,M. and Old,L.J.
Journal Int. J. Cancer 76 (5), 652-658 (1998)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878