• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens Snf2-related CREBBP activator protein (SRCAP), mRNA.


RefSeq Accession Definition Services Price Order
NM_006662 Homo sapiens Snf2-related CREBBP activator protein (SRCAP), mRNA. ORF Sequence Quote
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_006662.2, 146219842
Length 10491 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens Snf2-related CREBBP activator protein (SRCAP), mRNA.
Product helicase SRCAP
Comment

Summary: This gene encodes the core catalytic component of the multiprotein chromatin-remodeling SRCAP complex. The encoded protein is an ATPase that is necessary for the incorporation of the histone variant H2A.Z into nucleosomes. It can function as a transcriptional activator in Notch-mediated, CREB-mediated and steroid receptor-mediated transcription. Mutations in this gene cause Floating-Harbor syndrome, a rare disorder characterized by short stature, language deficits and dysmorphic facial features. [provided by RefSeq, Feb 2012].


Sequence Note:This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.


CCDS Note: The coding region has been updated to add an additional internal exon and to extend the N-terminus to one that is more supported by available transcript and conservation data. The N-terminal extension adds a HSA domain (found in DNA binding proteins and often associated with helicases) to the DEXDc, HELICc and AT_hook domains that are also found in this protein, and this is consistent with the function of this protein as a DNA helicase.

RefSeq NP_006653.2
CDS 386..10078
Misc Feature(1)71..73
Misc Feature(2)758..1072
Misc Feature(3)758..1072
Misc Feature(4)1127..1129
Misc Feature(5)1205..1207
Misc Feature(6)2099..2101
Misc Feature(7)2246..3106
Misc Feature(8)2297..2716
Misc Feature(9)2321..2335
Misc Feature(10)2621..2632
Misc Feature(11)6491..6877
Misc Feature(12)order(6584..6595,6653..6658,6737..6745)
Misc Feature(13)order(6761..6763,6824..6826,6836..6838,6845..6847)
Misc Feature(14)7157..7159
Misc Feature(15)7673..7675
Misc Feature(16)8903..8905
Misc Feature(17)8990..8992
Misc Feature(18)8990..8992
Misc Feature(19)9827..9829
Misc Feature(20)9827..9829
Misc Feature(21)9866..9868
Misc Feature(22)9899..9901
Misc Feature(23)9914..9916
Exon (1)1..102
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (2)103..176
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (3)177..439
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (4)440..691
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (5)692..877
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (6)878..1018
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (7)1019..1241
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (8)1242..1519
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (9)1520..1613
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (10)1614..1703
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (11)1704..1877
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (12)1878..2200
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (13)2201..2378
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (14)2379..2515
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (15)2516..2685
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (16)2686..2878
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (17)2879..3015
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (18)3016..3202
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (19)3203..3372
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (20)3373..3638
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (21)3639..3926
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (22)3927..4091
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (23)4092..4277
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (24)4278..4544
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (25)4545..6043
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (26)6044..6309
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (27)6310..6512
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (28)6513..6682
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (29)6683..6879
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (30)6880..6994
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (31)6995..7114
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (32)7115..7309
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (33)7310..7393
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (34)7394..10474
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Translation MQSSPSPAHPQLPVLQTQMVSDGMTGSNPVSPASSSSPASSGAGGISPQHIAQDSSLDGP PGPPDGATVPLEGFSLSQAADLANKGPKWEKSHAEIAEQAKHEAEIETRIAELRKEGFWS LKRLPKVPEPPRPKGHWDYLCEEMQWLSADFAQERRWKRGVARKVVRMVIRHHEEQRQKE ERARREEQAKLRRIASTMAKDVRQFWSNVEKVVQFKQQSRLEEKRKKALDLHLDFIVGQT EKYSDLLSQSLNQPLTSSKAGSSPCLGSSSAASSPPPPASRLDDEDGDFQPQEDEEEDDE ETIEVEEQQEGNDAEAQRREIELLRREGELPLEELLRSLPPQLLEGPSSPSQTPSSHDSD TRDGPEEGAEEEPPQVLEIKPPPSAVTQRNKQPWHPDEDDEEFTANEEEAEDEEDTIAAE EQLEGEVDHAMELSELAREGELSMEELLQQYAGAYAPGSGSSEDEDEDEVDANSSDCEPE GPVEAEEPPQEDSSSQSDSVEDRSEDEEDEHSEEEETSGSSASEESESEESEDAQSQSQA DEEEEDDDFGVEYLLARDEEQSEADAGSGPPTPGPTTLGPKKEITDIAAAAESLQPKGYT LATTQVKTPIPLLLRGQLREYQHIGLDWLVTMYEKKLNGILADEMGLGKTIQTISLLAHL ACEKGNWGPHLIIVPTSVMLNWEMELKRWCPSFKILTYYGAQKERKLKRQGWTKPNAFHV CITSYKLVLQDHQAFRRKNWRYLILDEAQNIKNFKSQRWQSLLNFNSQRRLLLTGTPLQN SLMELWSLMHFLMPHVFQSHREFKEWFSNPLTGMIEGSQEYNEGLVKRLHKVLRPFLLRR VKVDVEKQMPKKYEHVIRCRLSKRQRCLYDDFMAQTTTKETLATGHFMSVINILMQLRKV CNHPNLFDPRPVTSPFITPGICFSTASLVLRATDVHPLQRIDMGRFDLIGLEGRVSRYEA DTFLPRHRLSRRVLLEVATAPDPPPRPKPVKMKVNRMLQPVPKQEGRTVVVVNNPRAPLG PVPVRPPPGPELSAQPTPGPVPQVLPASLMVSASPAGPPLIPASRPPGPVLLPPLQPNSG SLPQVLPSPLGVLSGTSRPPTPTLSLKPTPPAPVRLSPAPPPGSSSLLKPLTVPPGYTFP PAAATTTSTTTATATTTAVPAPTPAPQRLILSPDMQARLPSGEVVSIGQLASLAQRPVAN AGGSKPLTFQIQGNKLTLTGAQVRQLAVGQPRPLQRNVVHLVSAGGQHHLISQPAHVALI QAVAPTPGPTPVSVLPSSTPSTTPAPTGLSLPLAANQVPPTMVNNTGVVKIVVRQAPRDG LTPVPPLAPAPRPPSSGLPAVLNPRPTLTPGRLPTPTLGTARAPMPTPTLVRPLLKLVHS PSPEVSASAPGAAPLTISSPLHVPSSLPGPASSPMPIPNSSPLASPVSSTVSVPLSSSLP ISVPTTLPAPASAPLTIPISAPLTVSASGPALLTSVTPPLAPVVPAAPGPPSLAPSGASP SASALTLGLATAPSLSSSQTPGHPLLLAPTSSHVPGLNSTVAPACSPVLVPASALASPFP SAPNPAPAQASLLAPASSASQALATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAP VLASSQTPVPVMAPSSTPGTSLASASPVPAPTPVLAPSSTQTMLPAPVPSPLPSPASTQT LALAPALAPTLGGSSPSQTLSLGTGNPQGPFPTQTLSLTPASSLVPTPAQTLSLAPGPPL GPTQTLSLAPAPPLAPASPVGPAPAHTLTLAPASSSASLLAPASVQTLTLSPAPVPTLGP AAAQTLALAPASTQSPASQASSLVVSASGAAPLPVTMVSRLPVSKDEPDTLTLRSGPPSP PSTATSFGGPRPRRQPPPPPRSPFYLDSLEEKRKRQRSERLERIFQLSEAHGALAPVYGT EVLDFCTLPQPVASPIGPRSPGPSHPTFWTYTEAAHRAVLFPQQRLDQLSEIIERFIFVM PPVEAPPPSLHACHPPPWLAPRQAAFQEQLASELWPRARPLHRIVCNMRTQFPDLRLIQY DCGKLQTLAVLLRQLKAEGHRVLIFTQMTRMLDVLEQFLTYHGHLYLRLDGSTRVEQRQA LMERFNADKRIFCFILSTRSGGVGVNLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRD VHIYRLISERTVEENILKKANQKRMLGDMAIEGGNFTTAYFKQQTIRELFDMPLEEPSSS SVPSAPEEEEETVASKQTHILEQALCRAEDEEDIRAATQAKAEQVAELAEFNENDGFPAG EGEEAGRPGAEDEEMSRAEQEIAALVEQLTPIERYAMKFLEASLEEVSREELKQAEEQVE AARKDLDQAKEEVFRLPQEEEEGPGAGDESSCGTGGGTHRRSKKAKAPERPGTRVSERLR GARAETQGANHTPVISAHQTRSTTTPPRCSPARERVPRPAPRPRPTPASAPAAIPALVPV PVSAPVPISAPNPITILPVHILPSPPPPSQIPPCSSPACTPPPACTPPPAHTPPPAQTCL VTPSSPLLLGPPSVPISASVTNLPLGLRPEAELCAQALASPESLELASVASSETSSLSLV PPKDLLPVAVEILPVSEKNLSLTPSAPSLTLEAGSIPNGQEQEAPDSAEGTTLTVLPEGE ELPLCVSESNGLELPPSAASDEPLQEPLEADRTSEELTEAKTPTSSPEKPQELVTAEVAA PSTSSSATSSPEGPSPARPPRRRTSADVEIRGQGTGRPGQPPGPKVLRKLPGRLVTVVEE KELVRRRRQQRGAASTLVPGVSETSASPGSPSVRSMSGPESSPPIGGPCEAAPSSSLPTP PQQPFIARRHIELGVTGGGSPENGDGALLAITPPAVKRRRGRPPKKNRSPADAGRGVDEA PSSTLKGKTNGADPVPGPETLIVADPVLEPQLIPGPQPLGPQPVHRPNPLLSPVEKRRRG RPPKARDLPIPGTISSAGDGNSESRTQPPPHPSPLTPLPPLLVCPTATVANTVTTVTIST SPPKRKRGRPPKNPPSPRPSQLPVLDRDSTSVLESCGLGRRRQPQGQGESEGSSSDEDGS RPLTRLARLRLEAEGMRGRKSGGSMVVAVIQDDLDLADSGPGGLELTPPVVSLTPKLRST RLRPGSLVPPLETEKLPRKRAGAPVGGSPGLAKRGRLQPPSPLGPEGSVEESEAEASGEE EEGDGTPRRRPGPRRLVGTTNQGDQRILRSSAPPSLAGPAVSHRGRKAKT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
70+dbSNP:
70+c, tdbSNP:117920831
234+dbSNP:
234+c, tdbSNP:185086484
259+c, gdbSNP:188432614
268+c, tdbSNP:34438928
348+c, tdbSNP:200417893
441+dbSNP:
441+a, tdbSNP:201001345
447+c, tdbSNP:183497403
452+a, gdbSNP:138333984
517+c, tdbSNP:149628651
518+a, gdbSNP:188276509
574+c, gdbSNP:79656879
608+a, gdbSNP:201959277
635+a, gdbSNP:200145878
697+dbSNP:
697+c, tdbSNP:200473396
776+c, gdbSNP:148079550
1020+dbSNP:
1020+g, tdbSNP:201126167
1153+c, tdbSNP:142391779
1185+g, tdbSNP:150504436
1208+c, tdbSNP:187562954
1228+c, tdbSNP:139542422
1365+dbSNP:
1365+a, gdbSNP:13331394
1405+c, tdbSNP:200460366
1441+a, gdbSNP:193098555
1487+a, gdbSNP:201481558
1501+g, tdbSNP:201361291
1547+dbSNP:
1547+c, gdbSNP:201156311
1548+a, tdbSNP:144472706
1664+dbSNP:
1664+a, gdbSNP:140083344
1724+dbSNP:
1724+c, tdbSNP:199841941
1735+a, gdbSNP:146916680
1742+c, gdbSNP:201556806
1831+c, tdbSNP:147749391
1839+c, tdbSNP:142622396
1878+dbSNP:
1878+a, tdbSNP:199716597
1892+c, tdbSNP:142287264
1944+a, gdbSNP:139339184
1974+a, gdbSNP:189047288
2029+, adbSNP:34931804
2111+a, gdbSNP:140425129
2123+c, tdbSNP:150430346
2152+a, gdbSNP:138290515
2185+a, gdbSNP:201021189
2274+dbSNP:
2274+g, tdbSNP:75456992
2377+a, gdbSNP:140349444
2449+dbSNP:
2449+g, tdbSNP:4889500
2455+c, tdbSNP:202088569
2535+dbSNP:
2535+c, tdbSNP:113192275
2629+a, gdbSNP:138153762
2716+dbSNP:
2716+a, cdbSNP:182177636
2717+c, tdbSNP:142663480
2727+a, gdbSNP:143899152
2950+dbSNP:
2950+c, tdbSNP:201399756
2957+c, tdbSNP:200723469
2958+c, tdbSNP:35892240
2959+c, tdbSNP:199816002
2974+a, gdbSNP:151062043
2975+c, tdbSNP:150750179
3033+dbSNP:
3033+c, gdbSNP:139524110
3040+a, c, tdbSNP:144028938
3096+c, tdbSNP:201160412
3158+a, cdbSNP:79523730
3159+c, tdbSNP:202065257
3173+c, tdbSNP:200873556
3246+dbSNP:
3246+a, gdbSNP:144689786
3268+c, tdbSNP:141067629
3279+c, tdbSNP:149854655
3282+a, gdbSNP:186883352
3297+a, gdbSNP:200896833
3318+c, tdbSNP:7203801
3337+a, cdbSNP:145842115
3352+a, tdbSNP:148513889
3429+dbSNP:
3429+c, tdbSNP:200143400
3436+a, gdbSNP:142759951
3482+c, tdbSNP:202000509
3501+g, tdbSNP:200405373
3514+a, gdbSNP:146588466
3554+a, gdbSNP:141288104
3557+c, tdbSNP:145506785
3561+c, tdbSNP:201831987
3567+c, tdbSNP:146483870
3586+c, tdbSNP:140807165
3590+c, tdbSNP:201405560
3594+a, tdbSNP:187027363
3597+c, tdbSNP:150167272
3608+c, gdbSNP:138628465
3639+dbSNP:
3639+c, tdbSNP:200083101
3659+g, tdbSNP:199662633
3687+a, cdbSNP:149248373
3688+a, gdbSNP:146926872
3724+a, gdbSNP:138041210
3744+c, tdbSNP:200913193
3773+c, tdbSNP:143519723
3888+a, gdbSNP:200884488
3898+a, gdbSNP:147309641
3917+c, tdbSNP:200261271
4020+dbSNP:
4020+a, gdbSNP:199994767
4056+a, gdbSNP:201658767
4061+c, gdbSNP:201583296
4084+c, tdbSNP:34734612
4106+dbSNP:
4106+c, tdbSNP:202233790
4249+c, tdbSNP:200348413
4253+a, gdbSNP:150246733
4307+dbSNP:
4307+c, gdbSNP:199498393
4359+c, tdbSNP:199761892
4387+a, gdbSNP:141507568
4420+c, gdbSNP:150909022
4425+c, tdbSNP:139402766
4448+a, gdbSNP:149991390
4461+g, tdbSNP:146547141
4464+c, tdbSNP:202028788
4485+c, tdbSNP:140099605
4552+dbSNP:
4552+a, cdbSNP:143704906
4574+a, gdbSNP:144657822
4588+c, gdbSNP:183580316
4591+c, tdbSNP:149090781
4603+a, cdbSNP:4889502
4607+c, g, tdbSNP:151230923
4628+a, gdbSNP:140379834
4678+c, gdbSNP:79597785
4722+c, gdbSNP:188267225
4736+a, gdbSNP:201769687
4740+c, tdbSNP:200175704
4767+c, tdbSNP:137897642
4788+c, tdbSNP:75035256
4858+c, gdbSNP:143372224
4878+c, gdbSNP:145894151
4883+c, gdbSNP:138424659
4942+a, gdbSNP:9652694
4948+a, tdbSNP:138541811
4950+a, gdbSNP:144776102
4973+a, gdbSNP:181190579
4981+a, cdbSNP:114204931
4988+c, gdbSNP:117804715
5003+a, gdbSNP:200086013
5006+a, gdbSNP:201407582
5048+c, tdbSNP:141527863
5065+a, gdbSNP:146141702
5087+c, gdbSNP:140025139
5108+c, tdbSNP:143556666
5167+a, gdbSNP:9652695
5186+c, tdbSNP:146336466
5190+c, tdbSNP:139296866
5191+a, gdbSNP:149726392
5204+c, gdbSNP:143623830
5209+g, tdbSNP:202226004
5215+a, gdbSNP:145563162
5238+c, tdbSNP:201158872
5245+c, tdbSNP:148913206
5268+a, gdbSNP:34832576
5280+c, tdbSNP:201039709
5325+c, tdbSNP:200403976
5368+a, gdbSNP:79592585
5391+c, tdbSNP:189892751
5404+a, gdbSNP:202139170
5415+a, cdbSNP:11859030
5419+a, gdbSNP:145301161
5497+a, gdbSNP:199654817
5508+a, cdbSNP:142637611
5591+c, gdbSNP:199521388
5605+a, gdbSNP:147634189
5639+c, tdbSNP:201580399
5642+c, gdbSNP:141977752
5685+c, tdbSNP:181491375
5704+a, tdbSNP:200756772
5705+c, tdbSNP:145751227
5707+a, gdbSNP:148227742
5746+a, gdbSNP:139549828
5788+c, tdbSNP:140196853
5805+c, tdbSNP:150467782
5818+a, cdbSNP:138278274
5823+c, tdbSNP:142909990
5915+c, tdbSNP:201101556
5916+c, gdbSNP:78037619
5928+c, tdbSNP:187062267
5965+g, tdbSNP:138996174
5991+g, tdbSNP:201036153
5995+c, tdbSNP:141985098
6016+c, gdbSNP:147477244
6055+dbSNP:
6055+a, gdbSNP:201513733
6090+a, gdbSNP:117480926
6092+c, tdbSNP:74015039
6178+c, tdbSNP:142865211
6200+c, tdbSNP:150630285
6241+c, tdbSNP:185115813
6254+c, tdbSNP:149539909
6255+a, gdbSNP:139158885
6260+a, gdbSNP:189172709
6275+c, gdbSNP:200516087
6339+dbSNP:
6339+a, cdbSNP:112447241
6352+c, gdbSNP:145200481
6371+c, tdbSNP:200767843
6412+a, tdbSNP:113939548
6467+a, gdbSNP:147650424
6514+dbSNP:
6514+a, gdbSNP:142252684
6517+a, gdbSNP:201175813
6525+c, tdbSNP:144253022
6550+c, gdbSNP:145457424
6614+c, gdbSNP:148813617
6812+dbSNP:
6812+a, tdbSNP:200901688
6886+dbSNP:
6886+c, tdbSNP:202092944
6943..6944+, cdbSNP:35949600
7019+dbSNP:
7019+a, gdbSNP:143500690
7038+c, tdbSNP:200230255
7049+a, gdbSNP:201837401
7056+c, tdbSNP:201111248
7100+c, tdbSNP:147999557
7201+dbSNP:
7201+c, tdbSNP:144274898
7208+a, gdbSNP:200249404
7212+a, gdbSNP:141357480
7245+a, gdbSNP:145099394
7275+g, tdbSNP:200940331
7351+dbSNP:
7351+c, tdbSNP:201157349
7504+dbSNP:
7504+a, gdbSNP:139029920
7506+a, cdbSNP:142242633
7542+a, gdbSNP:189201995
7557+c, gdbSNP:199646032
7558+a, gdbSNP:150413453
7603..7604+, tcdbSNP:199469467
7630+a, gdbSNP:200642861
7633+c, tdbSNP:138152469
7648+a, cdbSNP:74947321
7688+c, tdbSNP:199469465
7701..7702+, cdbSNP:199469468
7715+c, tdbSNP:199469464
7716+a, gdbSNP:146290947
7739+a, gdbSNP:144295177
7763+a, gdbSNP:140801551
7866+c, gdbSNP:200066296
7869+c, gdbSNP:201185965
7882+c, tdbSNP:143658051
7908+c, tdbSNP:201916514
7924+a, cdbSNP:34062097
7934+, cdbSNP:199469466
7956+c, gdbSNP:75125670
7977+c, tdbSNP:201373670
8059+a, gdbSNP:111829802
8081+c, tdbSNP:193056695
8162+c, tdbSNP:200333706
8235+c, tdbSNP:201670251
8238+a, gdbSNP:144476508
8254+a, gdbSNP:151210143
8255+a, gdbSNP:139052774
8276+a, tdbSNP:146127771
8385+c, gdbSNP:140120040
8414+c, gdbSNP:201459891
8425+c, tdbSNP:149868657
8435+a, gdbSNP:201528777
8444+c, tdbSNP:201748914
8474+a, gdbSNP:144963691
8482+a, gdbSNP:140878775
8488+a, gdbSNP:199705678
8515+a, gdbSNP:200346280
8526+a, cdbSNP:145133516
8611+a, gdbSNP:146844239
8717+c, gdbSNP:199502826
8718+g, tdbSNP:140641749
8732+c, gdbSNP:143819633
8735+a, cdbSNP:73538429
8748+c, tdbSNP:141858791
8758+a, gdbSNP:150187491
8765+c, tdbSNP:139190108
8772+c, tdbSNP:143103128
8782+a, gdbSNP:201825742
8791+c, tdbSNP:147473528
8839+c, tdbSNP:140511721
8844+c, tdbSNP:149290863
8867+c, tdbSNP:144623507
8868+a, gdbSNP:148477226
8870+a, cdbSNP:142523764
8885+a, gdbSNP:146421389
8900+a, gdbSNP:139886717
8909+a, gdbSNP:180684377
8916+c, gdbSNP:143277114
8933+g, tdbSNP:146681342
8974+c, tdbSNP:113103193
9022+a, cdbSNP:35057795
9061+g, tdbSNP:140675498
9088+a, gdbSNP:61746613
9138+c, gdbSNP:145422855
9140+c, tdbSNP:149217909
9145+a, gdbSNP:199928454
9236+c, gdbSNP:144944402
9250+c, gdbSNP:149043190
9257+a, gdbSNP:139049132
9271+c, tdbSNP:185172515
9278+c, tdbSNP:141497857
9279+a, gdbSNP:201043719
9296+c, tdbSNP:147068687
9297+a, gdbSNP:138363895
9362+a, gdbSNP:141276223
9367+c, gdbSNP:150765091
9374+a, gdbSNP:138111804
9445+c, tdbSNP:149533867
9497+c, tdbSNP:146017505
9507+a, gdbSNP:139814474
9581+a, cdbSNP:188422882
9611+a, gdbSNP:200710301
9614+a, cdbSNP:143133981
9682+c, tdbSNP:146224299
9721+a, gdbSNP:148423555
9829+c, tdbSNP:142948420
9840+c, tdbSNP:201223119
9862+c, gdbSNP:151087642
9872+c, gdbSNP:201927170
9912+a, cdbSNP:181312756
9947+c, tdbSNP:201133838
9965+c, tdbSNP:201229743
10018+c, tdbSNP:78465857
10110+a, gdbSNP:142064048
10125+a, gdbSNP:192066047
10161+a, tdbSNP:147764660
10421+, a, aadbSNP:34332331
Gene SymbolSRCAP
Gene SynonymDOMO1; EAF1; FLHS; SWR1
Chromosome16
Locus Map16p11.2
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_006662 Homo sapiens Snf2-related CREBBP activator protein (SRCAP), mRNA. Full Length Quote
ORF Sequence Quote
Title Mutations in SRCAP, encoding SNF2-related CREBBP activator protein, cause Floating-Harbor syndrome .
Author Hood,R.L., Lines,M.A., Nikkel,S.M., Schwartzentruber,J., Beaulieu,C., Nowaczyk,M.J., Allanson,J., Kim,C.A., Wieczorek,D., Moilanen,J.S., Lacombe,D., Gillessen-Kaesbach,G., Whiteford,M.L., Quaio,C.R., Gomy,I., Bertola,D.R., Albrecht,B., Platzer,K., McGillivray,G., Zou,R., McLeod,D.R., Chudley,A.E., Chodirker,B.N., Marcadier,J., Majewski,J., Bulman,D.E., White,S.M. and Boycott,K.M.
Journal Am. J. Hum. Genet. 90 (2), 308-313 (2012)
Title Gene reactivation by 5-aza-2'-deoxycytidine-induced demethylation requires SRCAP-mediated H2A.Z insertion to establish nucleosome depleted regions .
Author Yang,X., Noushmehr,H., Han,H., Andreu-Vieyra,C., Liang,G. and Jones,P.A.
Journal PLoS Genet. 8 (3), E1002604 (2012)
Title Loss of H2A.Z Is Not Sufficient to Determine Transcriptional Activity of Snf2-Related CBP Activator Protein or p400 Complexes .
Author Bowman,T.A., Wong,M.M., Cox,L.K., Baldassare,J.J. and Chrivia,J.C.
Journal Int J Cell Biol 2011, 715642 (2011)
Title Hepatitis C virus NS3 protein can activate the Notch-signaling pathway through binding to a transcription factor, SRCAP .
Author Iwai,A., Takegami,T., Shiozaki,T. and Miyazaki,T.
Journal PLoS ONE 6 (6), E20718 (2011)
Title Global levels of specific histone modifications and an epigenetic gene signature predict prostate cancer progression and development .
Author Bianco-Miotto,T., Chiam,K., Buchanan,G., Jindal,S., Day,T.K., Thomas,M., Pickering,M.A., O'Loughlin,M.A., Ryan,N.K., Raymond,W.A., Horvath,L.G., Kench,J.G., Stricker,P.D., Marshall,V.R., Sutherland,R.L., Henshall,S.M., Gerald,W.L., Scher,H.I., Risbridger,G.P., Clements,J.A., Butler,L.M., Tilley,W.D., Horsfall,D.J. and Ricciardelli,C.
Journal Cancer Epidemiol. Biomarkers Prev. 19 (10), 2611-2622 (2010)
Title SNF2-related CBP activator protein (SRCAP) functions as a coactivator of steroid receptor-mediated transcription through synergistic interactions with CARM-1 and GRIP-1 .
Author Monroy,M.A., Schott,N.M., Cox,L., Chen,J.D., Ruh,M. and Chrivia,J.C.
Journal Mol. Endocrinol. 17 (12), 2519-2528 (2003)
Title Adenovirus DNA binding protein inhibits SrCap-activated CBP and CREB-mediated transcription .
Author Xu,X., Tarakanova,V., Chrivia,J. and Yaciuk,P.
Journal Virology 313 (2), 615-621 (2003)
Title Regulation of cAMP-responsive element-binding protein-mediated transcription by the SNF2/SWI-related protein, SRCAP .
Author Monroy,M.A., Ruhl,D.D., Xu,X., Granner,D.K., Yaciuk,P. and Chrivia,J.C.
Journal J. Biol. Chem. 276 (44), 40721-40726 (2001)
Title Adenovirus DNA binding protein interacts with the SNF2-related CBP activator protein (SrCap) and inhibits SrCap-mediated transcription .
Author Xu,X., Chackalaparampil,I., Monroy,M.A., Cannella,M.T., Pesek,E., Chrivia,J. and Yaciuk,P.
Journal J. Virol. 75 (21), 10033-10040 (2001)
Title Identification of a novel SNF2/SWI2 protein family member, SRCAP, which interacts with CREB-binding protein .
Author Johnston,H., Kneer,J., Chackalaparampil,I., Yaciuk,P. and Chrivia,J.
Journal J. Biol. Chem. 274 (23), 16370-16376 (1999)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878