• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens Snf2-related CREBBP activator protein (SRCAP), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18021 Homo sapiens Snf2-related CREBBP activator protein (SRCAP), mRNA. pcDNA3.1+-DYK On-demand $4749.00 40
OHu18021C Homo sapiens Snf2-related CREBBP activator protein (SRCAP), mRNA. Customized vector On-demand $4749.00 40

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_006662.2, 146219842
Length 9693 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens Snf2-related CREBBP activator protein (SRCAP), mRNA.
Product helicase SRCAP
Comment

Summary: This gene encodes the core catalytic component of the multiprotein chromatin-remodeling SRCAP complex. The encoded protein is an ATPase that is necessary for the incorporation of the histone variant H2A.Z into nucleosomes. It can function as a transcriptional activator in Notch-mediated, CREB-mediated and steroid receptor-mediated transcription. Mutations in this gene cause Floating-Harbor syndrome, a rare disorder characterized by short stature, language deficits and dysmorphic facial features. [provided by RefSeq, Feb 2012].


Sequence Note:This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.


CCDS Note: The coding region has been updated to add an additional internal exon and to extend the N-terminus to one that is more supported by available transcript and conservation data. The N-terminal extension adds a HSA domain (found in DNA binding proteins and often associated with helicases) to the DEXDc, HELICc and AT_hook domains that are also found in this protein, and this is consistent with the function of this protein as a DNA helicase.

RefSeq NP_006653.2
CDS 386..10078
Misc Feature(1)71..73
Misc Feature(2)758..973
Misc Feature(3)758..973
Misc Feature(4)1127..1129
Misc Feature(5)1205..1207
Misc Feature(6)2099..2101
Misc Feature(7)2246..3106
Misc Feature(8)2297..2716
Misc Feature(9)2321..2335
Misc Feature(10)2621..2632
Misc Feature(11)4514..4765
Misc Feature(12)6491..6877
Misc Feature(13)order(6584..6595,6653..6658,6737..6745)
Misc Feature(14)order(6761..6763,6824..6826,6836..6838,6845..6847)
Misc Feature(15)7157..7159
Misc Feature(16)7673..7675
Misc Feature(17)8903..8905
Misc Feature(18)8990..8992
Misc Feature(19)8990..8992
Misc Feature(20)9827..9829
Misc Feature(21)9827..9829
Misc Feature(22)9866..9868
Misc Feature(23)9899..9901
Misc Feature(24)9914..9916
Exon (1)1..102
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (2)103..176
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (3)177..439
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (4)440..691
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (5)692..877
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (6)878..1018
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (7)1019..1241
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (8)1242..1519
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (9)1520..1613
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (10)1614..1703
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (11)1704..1877
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (12)1878..2200
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (13)2201..2378
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (14)2379..2515
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (15)2516..2685
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (16)2686..2878
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (17)2879..3015
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (18)3016..3202
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (19)3203..3372
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (20)3373..3638
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (21)3639..3926
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (22)3927..4091
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (23)4092..4277
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (24)4278..4544
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (25)4545..6043
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (26)6044..6309
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (27)6310..6512
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (28)6513..6682
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (29)6683..6879
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (30)6880..6994
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (31)6995..7114
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (32)7115..7309
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (33)7310..7393
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Exon (34)7394..10474
Gene:SRCAP
Gene Synonym:DOMO1; EAF1; FLHS; SWR1
Translation MQSSPSPAHPQLPVLQTQMVSDGMTGSNPVSPASSSSPASSGAGGISPQHIAQDSSLDGP PGPPDGATVPLEGFSLSQAADLANKGPKWEKSHAEIAEQAKHEAEIETRIAELRKEGFWS LKRLPKVPEPPRPKGHWDYLCEEMQWLSADFAQERRWKRGVARKVVRMVIRHHEEQRQKE ERARREEQAKLRRIASTMAKDVRQFWSNVEKVVQFKQQSRLEEKRKKALDLHLDFIVGQT EKYSDLLSQSLNQPLTSSKAGSSPCLGSSSAASSPPPPASRLDDEDGDFQPQEDEEEDDE ETIEVEEQQEGNDAEAQRREIELLRREGELPLEELLRSLPPQLLEGPSSPSQTPSSHDSD TRDGPEEGAEEEPPQVLEIKPPPSAVTQRNKQPWHPDEDDEEFTANEEEAEDEEDTIAAE EQLEGEVDHAMELSELAREGELSMEELLQQYAGAYAPGSGSSEDEDEDEVDANSSDCEPE GPVEAEEPPQEDSSSQSDSVEDRSEDEEDEHSEEEETSGSSASEESESEESEDAQSQSQA DEEEEDDDFGVEYLLARDEEQSEADAGSGPPTPGPTTLGPKKEITDIAAAAESLQPKGYT LATTQVKTPIPLLLRGQLREYQHIGLDWLVTMYEKKLNGILADEMGLGKTIQTISLLAHL ACEKGNWGPHLIIVPTSVMLNWEMELKRWCPSFKILTYYGAQKERKLKRQGWTKPNAFHV CITSYKLVLQDHQAFRRKNWRYLILDEAQNIKNFKSQRWQSLLNFNSQRRLLLTGTPLQN SLMELWSLMHFLMPHVFQSHREFKEWFSNPLTGMIEGSQEYNEGLVKRLHKVLRPFLLRR VKVDVEKQMPKKYEHVIRCRLSKRQRCLYDDFMAQTTTKETLATGHFMSVINILMQLRKV CNHPNLFDPRPVTSPFITPGICFSTASLVLRATDVHPLQRIDMGRFDLIGLEGRVSRYEA DTFLPRHRLSRRVLLEVATAPDPPPRPKPVKMKVNRMLQPVPKQEGRTVVVVNNPRAPLG PVPVRPPPGPELSAQPTPGPVPQVLPASLMVSASPAGPPLIPASRPPGPVLLPPLQPNSG SLPQVLPSPLGVLSGTSRPPTPTLSLKPTPPAPVRLSPAPPPGSSSLLKPLTVPPGYTFP PAAATTTSTTTATATTTAVPAPTPAPQRLILSPDMQARLPSGEVVSIGQLASLAQRPVAN AGGSKPLTFQIQGNKLTLTGAQVRQLAVGQPRPLQRNVVHLVSAGGQHHLISQPAHVALI QAVAPTPGPTPVSVLPSSTPSTTPAPTGLSLPLAANQVPPTMVNNTGVVKIVVRQAPRDG LTPVPPLAPAPRPPSSGLPAVLNPRPTLTPGRLPTPTLGTARAPMPTPTLVRPLLKLVHS PSPEVSASAPGAAPLTISSPLHVPSSLPGPASSPMPIPNSSPLASPVSSTVSVPLSSSLP ISVPTTLPAPASAPLTIPISAPLTVSASGPALLTSVTPPLAPVVPAAPGPPSLAPSGASP SASALTLGLATAPSLSSSQTPGHPLLLAPTSSHVPGLNSTVAPACSPVLVPASALASPFP SAPNPAPAQASLLAPASSASQALATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAP VLASSQTPVPVMAPSSTPGTSLASASPVPAPTPVLAPSSTQTMLPAPVPSPLPSPASTQT LALAPALAPTLGGSSPSQTLSLGTGNPQGPFPTQTLSLTPASSLVPTPAQTLSLAPGPPL GPTQTLSLAPAPPLAPASPVGPAPAHTLTLAPASSSASLLAPASVQTLTLSPAPVPTLGP AAAQTLALAPASTQSPASQASSLVVSASGAAPLPVTMVSRLPVSKDEPDTLTLRSGPPSP PSTATSFGGPRPRRQPPPPPRSPFYLDSLEEKRKRQRSERLERIFQLSEAHGALAPVYGT EVLDFCTLPQPVASPIGPRSPGPSHPTFWTYTEAAHRAVLFPQQRLDQLSEIIERFIFVM PPVEAPPPSLHACHPPPWLAPRQAAFQEQLASELWPRARPLHRIVCNMRTQFPDLRLIQY DCGKLQTLAVLLRQLKAEGHRVLIFTQMTRMLDVLEQFLTYHGHLYLRLDGSTRVEQRQA LMERFNADKRIFCFILSTRSGGVGVNLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRD VHIYRLISERTVEENILKKANQKRMLGDMAIEGGNFTTAYFKQQTIRELFDMPLEEPSSS SVPSAPEEEEETVASKQTHILEQALCRAEDEEDIRAATQAKAEQVAELAEFNENDGFPAG EGEEAGRPGAEDEEMSRAEQEIAALVEQLTPIERYAMKFLEASLEEVSREELKQAEEQVE AARKDLDQAKEEVFRLPQEEEEGPGAGDESSCGTGGGTHRRSKKAKAPERPGTRVSERLR GARAETQGANHTPVISAHQTRSTTTPPRCSPARERVPRPAPRPRPTPASAPAAIPALVPV PVSAPVPISAPNPITILPVHILPSPPPPSQIPPCSSPACTPPPACTPPPAHTPPPAQTCL VTPSSPLLLGPPSVPISASVTNLPLGLRPEAELCAQALASPESLELASVASSETSSLSLV PPKDLLPVAVEILPVSEKNLSLTPSAPSLTLEAGSIPNGQEQEAPDSAEGTTLTVLPEGE ELPLCVSESNGLELPPSAASDEPLQEPLEADRTSEELTEAKTPTSSPEKPQELVTAEVAA PSTSSSATSSPEGPSPARPPRRRTSADVEIRGQGTGRPGQPPGPKVLRKLPGRLVTVVEE KELVRRRRQQRGAASTLVPGVSETSASPGSPSVRSMSGPESSPPIGGPCEAAPSSSLPTP PQQPFIARRHIELGVTGGGSPENGDGALLAITPPAVKRRRGRPPKKNRSPADAGRGVDEA PSSTLKGKTNGADPVPGPETLIVADPVLEPQLIPGPQPLGPQPVHRPNPLLSPVEKRRRG RPPKARDLPIPGTISSAGDGNSESRTQPPPHPSPLTPLPPLLVCPTATVANTVTTVTIST SPPKRKRGRPPKNPPSPRPSQLPVLDRDSTSVLESCGLGRRRQPQGQGESEGSSSDEDGS RPLTRLARLRLEAEGMRGRKSGGSMVVAVIQDDLDLADSGPGGLELTPPVVSLTPKLRST RLRPGSLVPPLETEKLPRKRAGAPVGGSPGLAKRGRLQPPSPLGPEGSVEESEAEASGEE EEGDGTPRRRPGPRRLVGTTNQGDQRILRSSAPPSLAGPAVSHRGRKAKT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
70+dbSNP:
70+c, tdbSNP:117920831
234+dbSNP:
234+c, tdbSNP:185086484
244+c, tdbSNP:374941133
258+c, tdbSNP:369654583
259+c, gdbSNP:188432614
complement(268)-t, cdbSNP:34438928
333+a, tdbSNP:370745484
348+c, tdbSNP:200417893
371+c, tdbSNP:368667241
377+a, gdbSNP:375018234
418+a, gdbSNP:367593794
428+c, tdbSNP:371783481
441+dbSNP:
441+a, tdbSNP:201001345
447+c, tdbSNP:183497403
452+a, gdbSNP:138333984
509+a, gdbSNP:369999790
517+c, tdbSNP:149628651
518+a, gdbSNP:188276509
574+c, gdbSNP:79656879
578+c, gdbSNP:370333025
608+a, gdbSNP:201959277
635+a, gdbSNP:200145878
646+a, gdbSNP:375952582
667+c, tdbSNP:370329618
684+c, tdbSNP:374297760
697+dbSNP:
697+c, tdbSNP:200473396
703+c, tdbSNP:371291107
739+c, gdbSNP:367990784
776+c, gdbSNP:148079550
820+a, gdbSNP:377103085
874+a, gdbSNP:369720428
878+dbSNP:
878+c, gdbSNP:376390874
1020+dbSNP:
1020+g, tdbSNP:201126167
1117+g, tdbSNP:370705768
1153+c, tdbSNP:142391779
1185+g, tdbSNP:150504436
1208+c, tdbSNP:187562954
1215+c, tdbSNP:376353775
1228+c, tdbSNP:139542422
1257+dbSNP:
1257+c, tdbSNP:367675724
1352+c, tdbSNP:371751004
1365+a, gdbSNP:13331394
1390+g, tdbSNP:369979842
1393+c, tdbSNP:372295102
1394+c, tdbSNP:376483582
1405+c, tdbSNP:200460366
1441+a, gdbSNP:193098555
1449+c, tdbSNP:373319960
1450+a, gdbSNP:376622014
1487+a, gdbSNP:201481558
1501+g, tdbSNP:201361291
1547+dbSNP:
1547+c, gdbSNP:201156311
1548+a, tdbSNP:144472706
1550+c, tdbSNP:376370021
1664+dbSNP:
1664+a, gdbSNP:140083344
1715+dbSNP:
1715+a, gdbSNP:374747135
1724+c, tdbSNP:199841941
1735+a, gdbSNP:146916680
1742+c, gdbSNP:201556806
1799+a, gdbSNP:370167338
1831+c, tdbSNP:147749391
1839+c, tdbSNP:142622396
1840+a, gdbSNP:374930012
1859+a, gdbSNP:368411409
1878+dbSNP:
1878+a, tdbSNP:199716597
1892+c, tdbSNP:142287264
1896+a, gdbSNP:369286295
1944+a, gdbSNP:139339184
1974+a, gdbSNP:189047288
1976+g, tdbSNP:372450034
1999+c, tdbSNP:374756213
2005+a, cdbSNP:377073679
complement(2032)-, adbSNP:34931804
2111+a, gdbSNP:140425129
2123+c, tdbSNP:150430346
2152+a, gdbSNP:138290515
2185+a, gdbSNP:201021189
2234+dbSNP:
2234+c, tdbSNP:267604511
2274+g, tdbSNP:75456992
2292+a, gdbSNP:371111870
2377+a, gdbSNP:140349444
2379+dbSNP:
2379+a, gdbSNP:377510029
2410+c, tdbSNP:370658210
2449+g, tdbSNP:4889500
2455+c, tdbSNP:202088569
2535+dbSNP:
2535+c, tdbSNP:113192275
2545+a, gdbSNP:368797062
2606+c, tdbSNP:372334206
2629+a, gdbSNP:138153762
2713+dbSNP:
2713+c, tdbSNP:368981651
2716+a, cdbSNP:182177636
2717+c, tdbSNP:142663480
2727+a, gdbSNP:143899152
2783+c, tdbSNP:376643937
2950+dbSNP:
2950+c, tdbSNP:201399756
2957+c, tdbSNP:200723469
complement(2958)-t, cdbSNP:35892240
2959+c, tdbSNP:199816002
2974+a, gdbSNP:151062043
2975+c, tdbSNP:150750179
3033+dbSNP:
3033+c, gdbSNP:139524110
3040+a, c, tdbSNP:144028938
3096+c, tdbSNP:201160412
3106+c, tdbSNP:371709504
3158+a, cdbSNP:79523730
3159+c, tdbSNP:202065257
3161+g, tdbSNP:369964961
3173+c, tdbSNP:200873556
3176+a, gdbSNP:377312866
3183+c, tdbSNP:374240969
3212+dbSNP:
3212+a, gdbSNP:370552190
3246+a, gdbSNP:144689786
3268+c, tdbSNP:141067629
3279+c, tdbSNP:149854655
3281+c, tdbSNP:371592173
3282+a, gdbSNP:186883352
3288+a, gdbSNP:368876335
3296+c, tdbSNP:371893814
3297+a, gdbSNP:200896833
3318+c, tdbSNP:7203801
3337+a, cdbSNP:145842115
3352+a, tdbSNP:148513889
3429+dbSNP:
3429+c, tdbSNP:200143400
3436+a, gdbSNP:142759951
3482+c, tdbSNP:202000509
3501+g, tdbSNP:200405373
3514+a, gdbSNP:146588466
3549+c, tdbSNP:373016515
3554+a, gdbSNP:141288104
3557+c, tdbSNP:145506785
3561+c, tdbSNP:201831987
3567+c, tdbSNP:146483870
3586+c, tdbSNP:140807165
3590+c, tdbSNP:201405560
3594+a, tdbSNP:187027363
3597+c, tdbSNP:150167272
3608+c, gdbSNP:138628465
3629+c, tdbSNP:373743663
3639+dbSNP:
3639+c, tdbSNP:200083101
3659+g, tdbSNP:199662633
3678+c, gdbSNP:370202769
3687+a, cdbSNP:149248373
3688+a, gdbSNP:146926872
3744+c, tdbSNP:200913193
3746+c, tdbSNP:376896419
3773+c, tdbSNP:143519723
3826+c, tdbSNP:371524822
3866+a, gdbSNP:374725943
3888+a, gdbSNP:200884488
3898+a, gdbSNP:147309641
3904+c, tdbSNP:368322185
3917+c, tdbSNP:200261271
3920+c, tdbSNP:368076714
3971+dbSNP:
3971+c, tdbSNP:375393051
4020+a, gdbSNP:199994767
4056+a, gdbSNP:201658767
4061+c, gdbSNP:201583296
complement(4084)-t, cdbSNP:34734612
4106+dbSNP:
4106+c, tdbSNP:202233790
4221+a, cdbSNP:376985037
4228+c, gdbSNP:371374114
4236+c, gdbSNP:373755827
4249+c, tdbSNP:200348413
4253+a, gdbSNP:150246733
4287+dbSNP:
4287+c, tdbSNP:376954463
4307+c, gdbSNP:199498393
4329+a, gdbSNP:370342573
4331+a, gdbSNP:375447245
4342+c, tdbSNP:370642603
4359+c, tdbSNP:199761892
4387+a, gdbSNP:141507568
4405+c, tdbSNP:374342250
4420+c, gdbSNP:150909022
4425+c, tdbSNP:139402766
4448+a, gdbSNP:149991390
4464+c, tdbSNP:202028788
4467+c, tdbSNP:367874972
4473+c, gdbSNP:372507463
4485+c, tdbSNP:140099605
4534+c, tdbSNP:377295886
4552+dbSNP:
4552+a, cdbSNP:143704906
4574+a, gdbSNP:144657822
4588+c, gdbSNP:183580316
4591+c, tdbSNP:149090781
4603+a, cdbSNP:4889502
4607+c, g, tdbSNP:151230923
4628+a, gdbSNP:140379834
4678+c, gdbSNP:79597785
4698+c, tdbSNP:367694674
4722+c, gdbSNP:188267225
4736+a, c, gdbSNP:201769687
4740+c, tdbSNP:200175704
4745+a, cdbSNP:372567989
4767+c, tdbSNP:137897642
4769+c, tdbSNP:377232050
4788+c, tdbSNP:75035256
4842+c, tdbSNP:377218192
4858+c, gdbSNP:143372224
4878+c, gdbSNP:145894151
4883+c, gdbSNP:138424659
4923+c, tdbSNP:372301832
4942+a, gdbSNP:9652694
4942+a, gdbSNP:386624058
4948+a, tdbSNP:138541811
4950+a, gdbSNP:144776102
4973+a, gdbSNP:181190579
4981+a, cdbSNP:114204931
4988+c, gdbSNP:117804715
5003+a, gdbSNP:200086013
5006+a, gdbSNP:201407582
5017+a, gdbSNP:377089817
5048+c, tdbSNP:141527863
5064+c, tdbSNP:369714554
5065+a, gdbSNP:146141702
5079+c, tdbSNP:375336306
5083+c, tdbSNP:369096758
5087+c, gdbSNP:140025139
5108+c, tdbSNP:143556666
5167+a, gdbSNP:9652695
5201+c, tdbSNP:372565320
5204+c, gdbSNP:143623830
5209+g, tdbSNP:202226004
5231+c, gdbSNP:372224213
5238+c, tdbSNP:201158872
5245+c, tdbSNP:148913206
5257+a, gdbSNP:377094082
complement(5268)-g, adbSNP:34832576
5280+c, tdbSNP:201039709
5325+c, tdbSNP:200403976
5326+a, gdbSNP:369712363
5368+a, gdbSNP:79592585
5391+c, tdbSNP:189892751
5404+a, gdbSNP:202139170
5409+c, tdbSNP:376226977
5415+a, cdbSNP:11859030
5419+a, gdbSNP:145301161
5497+a, gdbSNP:199654817
5508+a, cdbSNP:142637611
5557+c, gdbSNP:375239106
5583+c, gdbSNP:372002745
5591+c, gdbSNP:199521388
5605+a, gdbSNP:147634189
5623+a, gdbSNP:376380059
5630+g, tdbSNP:371043977
5639+c, tdbSNP:201580399
5642+c, gdbSNP:141977752
5685+c, tdbSNP:181491375
5704+a, tdbSNP:200756772
5705+c, tdbSNP:145751227
5746+a, gdbSNP:139549828
5765+c, gdbSNP:371358460
5775+c, tdbSNP:373922349
5785+a, gdbSNP:368049243
5788+c, tdbSNP:140196853
5805+c, tdbSNP:150467782
5818+a, cdbSNP:138278274
5823+c, tdbSNP:142909990
5854+c, tdbSNP:370111987
5862+c, tdbSNP:374858506
5875+c, tdbSNP:368425935
5876+a, gdbSNP:372712109
5915+c, tdbSNP:201101556
5916+c, gdbSNP:78037619
5928+c, tdbSNP:187062267
5965+g, tdbSNP:138996174
5967+c, tdbSNP:372557565
5991+g, tdbSNP:201036153
5995+c, tdbSNP:141985098
5997+a, gdbSNP:375163006
6016+c, gdbSNP:147477244
6026+c, tdbSNP:267604512
6055+dbSNP:
6055+a, gdbSNP:201513733
6090+a, gdbSNP:117480926
6092+c, tdbSNP:74015039
6178+c, tdbSNP:142865211
6200+c, tdbSNP:150630285
6212+c, tdbSNP:372463671
6241+c, tdbSNP:185115813
6254+c, tdbSNP:149539909
6255+a, gdbSNP:139158885
6260+a, gdbSNP:189172709
6275+c, gdbSNP:200516087
6339+dbSNP:
6339+a, cdbSNP:112447241
6352+c, gdbSNP:145200481
6357+a, tdbSNP:369063456
6371+c, tdbSNP:200767843
6412+a, tdbSNP:113939548
6413+c, tdbSNP:376501621
6434+c, tdbSNP:369481213
6452+c, tdbSNP:376342702
6467+a, gdbSNP:147650424
6514+dbSNP:
6514+a, gdbSNP:142252684
6517+a, gdbSNP:201175813
6523+a, gdbSNP:368881962
6525+c, tdbSNP:144253022
6542+c, tdbSNP:371915992
6550+c, gdbSNP:145457424
6599+c, tdbSNP:375184795
6614+c, gdbSNP:148813617
6687+dbSNP:
6687+c, tdbSNP:368885190
6713+c, tdbSNP:371360318
6812+a, tdbSNP:200901688
6886+dbSNP:
6886+c, tdbSNP:202092944
6898+a, gdbSNP:369734800
complement(6947..6948)-, cdbSNP:35949600
7019+dbSNP:
7019+a, gdbSNP:143500690
7038+c, tdbSNP:200230255
7049+a, gdbSNP:201837401
7056+c, tdbSNP:201111248
7096+c, gdbSNP:370171603
7100+c, tdbSNP:147999557
7166+dbSNP:
7166+a, gdbSNP:371164171
7199+a, cdbSNP:375872512
7200+a, gdbSNP:369102676
7201+c, tdbSNP:144274898
7208+a, gdbSNP:200249404
7212+a, gdbSNP:141357480
7245+a, gdbSNP:145099394
7275+g, tdbSNP:200940331
7351+dbSNP:
7351+c, tdbSNP:201157349
7504+dbSNP:
7504+a, gdbSNP:139029920
7506+a, cdbSNP:142242633
7542+a, gdbSNP:189201995
7557+c, gdbSNP:199646032
7558+a, gdbSNP:150413453
7603..7604+, tcdbSNP:199469467
7630+a, gdbSNP:200642861
7633+c, tdbSNP:138152469
7648+a, cdbSNP:74947321
7648+a, cdbSNP:386441167
7671+a, gdbSNP:370353071
7688+c, tdbSNP:199469465
7701..7702+, cdbSNP:199469468
7715+c, tdbSNP:199469464
7716+a, gdbSNP:146290947
7719+c, tdbSNP:370256356
7739+a, gdbSNP:144295177
7763+a, gdbSNP:140801551
7777+a, cdbSNP:374697927
7802+c, gdbSNP:367996537
7836+c, tdbSNP:373855752
7866+c, gdbSNP:200066296
7869+c, gdbSNP:201185965
7908+c, tdbSNP:201916514
7924+a, cdbSNP:34062097
7934+, cdbSNP:199469466
7956+c, gdbSNP:75125670
7977+c, tdbSNP:201373670
7993+c, tdbSNP:267604513
8059+a, gdbSNP:111829802
8081+c, tdbSNP:193056695
8108+a, tdbSNP:368587038
8150+a, gdbSNP:370775352
8162+c, tdbSNP:200333706
8235+c, tdbSNP:201670251
8238+a, gdbSNP:144476508
8254+a, gdbSNP:151210143
8255+a, gdbSNP:139052774
8276+a, tdbSNP:146127771
8277+c, tdbSNP:368107059
8286+c, gdbSNP:370304188
8385+c, g, tdbSNP:140120040
8406+c, tdbSNP:372720918
8407+a, gdbSNP:377316701
8414+c, gdbSNP:201459891
8425+c, tdbSNP:149868657
8435+a, gdbSNP:201528777
8444+c, tdbSNP:201748914
8459+c, gdbSNP:372106146
8474+a, gdbSNP:144963691
8482+a, gdbSNP:140878775
8488+a, gdbSNP:199705678
8515+a, gdbSNP:200346280
8526+a, cdbSNP:145133516
8611+a, gdbSNP:146844239
8675+a, gdbSNP:373763235
8706+c, gdbSNP:371672233
8717+c, gdbSNP:199502826
8718+g, tdbSNP:140641749
8732+c, gdbSNP:143819633
8735+a, cdbSNP:73538429
8748+c, tdbSNP:141858791
8757+c, tdbSNP:374720304
8758+a, gdbSNP:150187491
8765+c, tdbSNP:139190108
8772+c, tdbSNP:143103128
8782+a, gdbSNP:201825742
8790+c, tdbSNP:376510159
8791+c, tdbSNP:147473528
8798+a, gdbSNP:369664039
8839+c, tdbSNP:140511721
8844+c, tdbSNP:149290863
8848+c, tdbSNP:377100819
8867+c, tdbSNP:144623507
8868+a, gdbSNP:148477226
8870+a, cdbSNP:142523764
8883+c, tdbSNP:377015584
8885+a, gdbSNP:146421389
8900+a, gdbSNP:139886717
8909+a, gdbSNP:180684377
8916+c, gdbSNP:143277114
8933+g, tdbSNP:146681342
8936+a, gdbSNP:374400862
8974+c, g, tdbSNP:113103193
complement(9022)-c, adbSNP:35057795
9027+c, tdbSNP:377394919
9036+c, tdbSNP:375027179
9061+g, tdbSNP:140675498
9085+c, gdbSNP:370400235
9088+a, gdbSNP:61746613
9138+c, gdbSNP:145422855
9140+c, tdbSNP:149217909
9145+a, gdbSNP:199928454
9168+a, gdbSNP:376066291
9183+c, tdbSNP:368577129
9198+a, gdbSNP:372357659
9230+c, tdbSNP:368649967
9236+c, gdbSNP:144944402
9238+g, tdbSNP:367970661
9245+a, gdbSNP:371687815
9250+c, gdbSNP:149043190
9257+a, gdbSNP:139049132
9271+c, tdbSNP:185172515
9272+a, gdbSNP:375006393
9278+c, tdbSNP:141497857
9279+a, gdbSNP:201043719
9296+c, tdbSNP:147068687
9297+a, gdbSNP:138363895
9343+c, tdbSNP:368889629
9348+c, tdbSNP:369907818
9362+a, gdbSNP:141276223
9367+c, gdbSNP:150765091
9374+a, gdbSNP:138111804
9424+c, tdbSNP:373514967
9445+c, tdbSNP:149533867
9465+a, gdbSNP:376725094
9497+c, tdbSNP:146017505
9507+a, gdbSNP:139814474
9581+a, cdbSNP:188422882
9611+a, gdbSNP:200710301
9614+a, cdbSNP:143133981
9638+a, gdbSNP:369935740
9682+c, tdbSNP:146224299
9694+a, gdbSNP:376959784
9721+a, gdbSNP:148423555
9750+g, tdbSNP:373627980
9776+c, gdbSNP:370178143
9778+a, gdbSNP:371059850
9829+c, tdbSNP:142948420
9840+c, tdbSNP:201223119
9852+a, gdbSNP:371418984
9862+c, gdbSNP:151087642
9872+c, gdbSNP:201927170
9912+a, cdbSNP:181312756
9920..9922+, gagdbSNP:376601598
9947+c, tdbSNP:201133838
9948+a, gdbSNP:375261813
9965+c, tdbSNP:201229743
9966+a, gdbSNP:368382734
10018+c, tdbSNP:78465857
10048+c, tdbSNP:372423298
10100+g, tdbSNP:376319548
10110+a, gdbSNP:142064048
10116+a, cdbSNP:368747756
10125+a, gdbSNP:192066047
10161+a, tdbSNP:147764660
complement(10421)-, adbSNP:34332331
complement(10436)-, adbSNP:397854666
Gene SymbolSRCAP
Gene SynonymDOMO1; EAF1; FLHS; SWR1
Chromosome16
Locus Map16p11.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006662 Homo sapiens Snf2-related CREBBP activator protein (SRCAP), mRNA. On-demand $4749.00 40
Title Not all floating-harbor syndrome cases are due to mutations in exon 34 of SRCAP .
Author Le Goff C, Mahaut C, Bottani A, Doray B, Goldenberg A, Moncla A, Odent S, Nitschke P, Munnich A, Faivre L and Cormier-Daire V.
Journal Hum. Mutat. 34 (1), 88-92 (2013)
Title Floating-Harbor syndrome and polycystic kidneys associated with .
Author Reschen M, Kini U, Hood RL, Boycott KM, Hurst J and O'Callaghan CA.
Journal Am. J. Med. Genet. A 158A (12), 3196-3200 (2012)
Title Mutations in SRCAP, encoding SNF2-related CREBBP activator protein, cause Floating-Harbor syndrome .
Author Hood RL, Lines MA, Nikkel SM, Schwartzentruber J, Beaulieu C, Nowaczyk MJ, Allanson J, Kim CA, Wieczorek D, Moilanen JS, Lacombe D, Gillessen-Kaesbach G, Whiteford ML, Quaio CR, Gomy I, Bertola DR, Albrecht B, Platzer K, McGillivray G, Zou R, McLeod DR, Chudley AE, Chodirker BN, Marcadier J, Majewski J, Bulman DE, White SM and Boycott KM.
Journal Am. J. Hum. Genet. 90 (2), 308-313 (2012)
Title Gene reactivation by 5-aza-2'-deoxycytidine-induced demethylation requires SRCAP-mediated H2A.Z insertion to establish nucleosome depleted regions .
Author Yang X, Noushmehr H, Han H, Andreu-Vieyra C, Liang G and Jones PA.
Journal PLoS Genet. 8 (3), E1002604 (2012)
Title Loss of H2A.Z Is Not Sufficient to Determine Transcriptional Activity of Snf2-Related CBP Activator Protein or p400 Complexes .
Author Bowman TA, Wong MM, Cox LK, Baldassare JJ and Chrivia JC.
Journal Int J Cell Biol 2011, 715642 (2011)
Title Adenovirus DNA binding protein inhibits SrCap-activated CBP and CREB-mediated transcription .
Author Xu X, Tarakanova V, Chrivia J and Yaciuk P.
Journal Virology 313 (2), 615-621 (2003)
Title Regulation of cAMP-responsive element-binding protein-mediated transcription by the SNF2/SWI-related protein, SRCAP .
Author Monroy MA, Ruhl DD, Xu X, Granner DK, Yaciuk P and Chrivia JC.
Journal J. Biol. Chem. 276 (44), 40721-40726 (2001)
Title Adenovirus DNA binding protein interacts with the SNF2-related CBP activator protein (SrCap) and inhibits SrCap-mediated transcription .
Author Xu X, Chackalaparampil I, Monroy MA, Cannella MT, Pesek E, Chrivia
Journal J. Virol. 75 (21), 10033-10040 (2001)
Title Identification of a novel SNF2/SWI2 protein family member, SRCAP, which interacts with CREB-binding protein .
Author Johnston H, Kneer J, Chackalaparampil I, Yaciuk P and Chrivia J.
Journal J. Biol. Chem. 274 (23), 16370-16376 (1999)
Title Floating-Harbor Syndrome .
Author Nowaczyk,M.J.M., Nikkel,S.M. and White,S.M.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.