• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cytochrome P450, family 46, subfamily A, polypeptide 1 (CYP46A1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18783 Homo sapiens cytochrome P450, family 46, subfamily A, polypeptide 1 (CYP46A1), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu18783C Homo sapiens cytochrome P450, family 46, subfamily A, polypeptide 1 (CYP46A1), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_006668.1, 5729795
Length 1503 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens cytochrome P450, family 46, subfamily A, polypeptide 1 (CYP46A1), mRNA.
Product cholesterol 24-hydroxylase precursor
Comment

Summary: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein is expressed in the brain, where it converts cholesterol to 24S-hydroxycholesterol. While cholesterol cannot pass the blood-brain barrier, 24S-hydroxycholesterol can be secreted in the brain into the circulation to be returned to the liver for catabolism. [provided by RefSeq, Jul 2008].

RefSeq NP_006659.1
CDS 1..1503
Misc Feature(1)7..69
Misc Feature(2)100..1398
Misc Feature(3)1309..1311
Exon (1)120..200
Gene:CYP46A1
Gene Synonym:CP46; CYP46
Exon (2)201..282
Gene:CYP46A1
Gene Synonym:CP46; CYP46
Exon (3)283..356
Gene:CYP46A1
Gene Synonym:CP46; CYP46
Exon (4)357..443
Gene:CYP46A1
Gene Synonym:CP46; CYP46
Exon (5)444..582
Gene:CYP46A1
Gene Synonym:CP46; CYP46
Exon (6)583..693
Gene:CYP46A1
Gene Synonym:CP46; CYP46
Exon (7)694..844
Gene:CYP46A1
Gene Synonym:CP46; CYP46
Exon (8)845..907
Gene:CYP46A1
Gene Synonym:CP46; CYP46
Exon (9)908..980
Gene:CYP46A1
Gene Synonym:CP46; CYP46
Exon (10)981..1065
Gene:CYP46A1
Gene Synonym:CP46; CYP46
Exon (11)1066..1176
Gene:CYP46A1
Gene Synonym:CP46; CYP46
Exon (12)1177..1265
Gene:CYP46A1
Gene Synonym:CP46; CYP46
Exon (13)1266..1332
Gene:CYP46A1
Gene Synonym:CP46; CYP46
Exon (14)1333..2077
Gene:CYP46A1
Gene Synonym:CP46; CYP46
Translation MSPGLLLLGSAVLLAFGLCCTFVHRARSRYEHIPGPPRPSFLLGHLPCFWKKDEVGGRVL QDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERL FGQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSM QDMLTYTAMDILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQL REVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFF IAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKES LRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGA PKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLD PVLCTLRPRGWQPAPPPPPC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
173+dbSNP:
173+a, gdbSNP:200569884
219+dbSNP:
219+c, tdbSNP:141032633
378+dbSNP:
378+g, tdbSNP:144966483
381+c, tdbSNP:139245529
478+dbSNP:
478+a, gdbSNP:75832974
536+a, cdbSNP:368496205
559+a, cdbSNP:74730047
562+a, gdbSNP:148568536
585+dbSNP:
585+a, tdbSNP:368295416
629+c, tdbSNP:267604122
633+c, gdbSNP:372548812
722+dbSNP:
722+a, gdbSNP:142905408
785+a, gdbSNP:151175005
828+c, tdbSNP:201604068
840+g, tdbSNP:201085949
896+dbSNP:
896+c, tdbSNP:78767954
912+dbSNP:
912+c, gdbSNP:200661407
960+c, tdbSNP:370474237
969+g, tdbSNP:112687989
972+c, tdbSNP:187491029
975+a, gdbSNP:201760580
978+a, gdbSNP:372949820
990+dbSNP:
990+c, tdbSNP:188075791
1023+c, tdbSNP:374987652
1048+c, tdbSNP:368904176
1053+a, gdbSNP:370665505
1101+dbSNP:
1101+a, g, tdbSNP:200110496
1134+c, tdbSNP:143992631
1159+a, gdbSNP:146435738
1170+a, gdbSNP:140794624
1221+dbSNP:
1221+c, tdbSNP:375146687
1224+a, gdbSNP:369668371
1248+c, tdbSNP:199588723
1249+c, gdbSNP:201296209
1270+dbSNP:
1270+c, tdbSNP:200564104
1281+c, tdbSNP:200043004
1314+c, tdbSNP:201784451
1333+dbSNP:
1333+a, gdbSNP:144915500
1376+a, tdbSNP:138751864
1381+c, tdbSNP:148881618
1392+c, tdbSNP:143537324
1416+a, gdbSNP:371696839
1444+g, tdbSNP:200877443
1446+a, gdbSNP:369621046
1459+c, tdbSNP:369066335
1513+c, tdbSNP:374391699
1550+a, gdbSNP:144296616
1568+c, tdbSNP:377757226
1593+c, tdbSNP:187836713
1594+c, tdbSNP:193231294
1601+c, tdbSNP:185303723
1644+a, cdbSNP:190228579
complement(1689)-g, adbSNP:148734093
1869+c, tdbSNP:373000472
1877+c, tdbSNP:142328283
1932+c, tdbSNP:192811535
1977+c, tdbSNP:147831141
complement(1998)-t, cdbSNP:15506
complement(2064)-g, adbSNP:141330096
Gene SymbolCYP46A1
Gene SynonymCP46; CYP46
Chromosome14
Locus Map14q32.1
Title CYP46A1 intron-2T/C polymorphism and Alzheimer's disease: an updated meta-analysis of 16 studies including 3,960 cases and 3,828 controls .
Author Li M, Wang W, Li Y, Wang L, Shen X and Tang Z.
Journal Neurosci. Lett. 549, 18-23 (2013)
Title Antifungal Azoles: Structural Insights into Undesired Tight Binding to Cholesterol-Metabolizing CYP46A1 .
Author Mast N, Zheng W, Stout CD and Pikuleva IA.
Journal Mol. Pharmacol. 84 (1), 86-94 (2013)
Title CYP46A1 T/C polymorphism associated with the APOE epsilon4 allele increases the risk of Alzheimer's disease .
Author Li L, Yin Z, Liu J, Li G, Wang Y, Yan J and Zhou H.
Journal J. Neurol. 260 (7), 1701-1708 (2013)
Title Association of CYP46 gene polymorphism with sporadic Alzheimer's disease in Chinese Han populations: a meta-analysis .
Author Jin C, Zhang F, Zhu J, Yuan J, Xia M, Xu Q, Jiang X, Wu Y and Xu W.
Journal Int. J. Neurosci. 123 (4), 226-232 (2013)
Title Binding of a cyano- and fluoro-containing drug bicalutamide to cytochrome P450 46A1: unusual features and spectral response .
Author Mast N, Zheng W, Stout CD and Pikuleva IA.
Journal J. Biol. Chem. 288 (7), 4613-4624 (2013)
Title Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants .
Author Nelson DR, Zeldin DC, Hoffman SM, Maltais LJ, Wain HM and Nebert DW.
Journal Pharmacogenetics 14 (1), 1-18 (2004)
Title On the turnover of brain cholesterol in patients with Alzheimer's disease. Abnormal induction of the cholesterol-catabolic enzyme CYP46 in glial cells .
Author Bogdanovic N, Bretillon L, Lund EG, Diczfalusy U, Lannfelt L, Winblad B, Russell DW and Bjorkhem I.
Journal Neurosci. Lett. 314 (1-2), 45-48 (2001)
Title Oxysterol biosynthetic enzymes .
Author Russell DW.
Journal Biochim. Biophys. Acta 1529 (1-3), 126-135 (2000)
Title cDNA cloning of cholesterol 24-hydroxylase, a mediator of cholesterol homeostasis in the brain .
Author Lund EG, Guileyardo JM and Russell DW.
Journal Proc. Natl. Acad. Sci. U.S.A. 96 (13), 7238-7243 (1999)
Title Cholesterol homeostasis in human brain: turnover of 24S-hydroxycholesterol and evidence for a cerebral origin of most of this oxysterol in the circulation .
Author Bjorkhem I, Lutjohann D, Diczfalusy U, Stahle L, Ahlborg G and Wahren J.
Journal J. Lipid Res. 39 (8), 1594-1600 (1998)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.