• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens pleiomorphic adenoma gene-like 1 (PLAGL1), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19858 Homo sapiens pleiomorphic adenoma gene-like 1 (PLAGL1), transcript variant 2, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu19858C Homo sapiens pleiomorphic adenoma gene-like 1 (PLAGL1), transcript variant 2, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_006718.3, 124381122
Length 1392 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens pleiomorphic adenoma gene-like 1 (PLAGL1), transcript variant 2, mRNA.
Product zinc finger protein PLAGL1 isoform 2
Comment

Summary: This gene encodes a C2H2 zinc finger protein with transactivation and DNA-binding activities. It has been shown to have anti-proliferative properties, and thus thought to function as a tumor suppressor. In addition, overexpression of this gene during fetal development is believed to underlie the rare disorder, transient neonatal diabetes mellitus (TNDM). This gene is imprinted, with preferential expression of the paternal allele in many tissues, however, biallelic expression has been noted in peripheral blood leucocytes. A recent study reports that tissue-specific imprinting results from variable utilization of monoallelic and biallelic promoters. Many transcript variants differing in the 5' UTR and encoding two different isoforms, have been found for this gene. [provided by RefSeq, Oct 2010].


Transcript Variant: This variant (2) differs in the 5' UTR and contains an alternate exon in the CDS compared to variant 1. The resulting isoform (2) is longer and has an extended N-terminus compared to isoform 1. Variants 2, 3, 4, 5, 6, 10, 12, 15, 16, 17, 18, 19 and 20 all encode the same isoform (2).

RefSeq NP_006709.2
CDS 891..2282
Misc Feature(1)876..878
Misc Feature(2)1035..1109
Misc Feature(3)1035..1109
Misc Feature(4)<1128..>1511
Exon (1)1..315
Gene:PLAGL1
Gene Synonym:LOT1; ZAC; ZAC1
Exon (2)316..387
Gene:PLAGL1
Gene Synonym:LOT1; ZAC; ZAC1
Exon (3)388..460
Gene:PLAGL1
Gene Synonym:LOT1; ZAC; ZAC1
Exon (4)461..492
Gene:PLAGL1
Gene Synonym:LOT1; ZAC; ZAC1
Exon (5)493..566
Gene:PLAGL1
Gene Synonym:LOT1; ZAC; ZAC1
Exon (6)567..1042
Gene:PLAGL1
Gene Synonym:LOT1; ZAC; ZAC1
Exon (7)1043..3406
Gene:PLAGL1
Gene Synonym:LOT1; ZAC; ZAC1
Translation MATFPCQLCGKTFLTLEKFTIHNYSHSRERPYKCVQPDCGKAFVSRYKLMRHMATHSPQK SHQCAHCEKTFNRKDHLKNHLQTHDPNKMAFGCEECGKKYNTMLGYKRHLALHAASSGDL TCGVCALELGSTEVLLDHLKAHAEEKPPSGTKEKKHQCDHCERCFYTRKDVRRHLVVHTG CKDFLCQFCAQRFGRKDHLTRHTKKTHSQELMKESLQTGDLLSTFHTISPSFQLKAAALP PFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSPPPPLPN HKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVN LPKELPADAVNLTIPASLDLSPLLGFWQLPPPATQNTFGNSTLALGPGESLPHRLSCLGQ QQQEPPLAMGTVSLGQLPLPPIPHVFSAGTGSAILPHFHHAFR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(130)-dbSNP:
complement(130)-t, adbSNP:188083405
complement(180)-t, cdbSNP:113189219
complement(279)-t, cdbSNP:67300369
complement(421)-dbSNP:
complement(421)-g, adbSNP:192562088
complement(434)-t, cdbSNP:368424368
complement(469)-dbSNP:
complement(469)-t, adbSNP:370220800
complement(623)-dbSNP:
complement(623)-g, cdbSNP:2076684
complement(710)-g, adbSNP:370977690
complement(714)-c, adbSNP:77502692
complement(751)-g, adbSNP:138964933
complement(769)-t, cdbSNP:191543871
complement(822)-g, adbSNP:145922363
complement(900)-g, adbSNP:147037984
complement(926)-t, cdbSNP:141506249
complement(938)-g, cdbSNP:147962624
complement(950)-t, cdbSNP:201628824
complement(979)-t, cdbSNP:201696236
complement(989)-t, cdbSNP:377168292
complement(1014)-t, cdbSNP:371685096
complement(1034)-t, cdbSNP:367667352
complement(1035)-t, g, adbSNP:186779775
complement(1100)-dbSNP:
complement(1100)-t, cdbSNP:144954752
complement(1165)-t, cdbSNP:139967852
complement(1252)-g, adbSNP:201937527
complement(1257)-c, adbSNP:201753929
complement(1277)-t, cdbSNP:368641715
complement(1281)-t, cdbSNP:151100437
complement(1286)-g, adbSNP:142899386
complement(1290)-g, cdbSNP:148432028
complement(1295)-t, gdbSNP:374451635
1311+g, tdbSNP:17847327
complement(1319)-t, cdbSNP:17073229
complement(1418)-t, cdbSNP:267600848
complement(1475)-g, adbSNP:141784122
1480+a, tdbSNP:1063413
complement(1496)-t, cdbSNP:36120645
complement(1531)-g, adbSNP:34652819
complement(1541)-g, cdbSNP:375679973
complement(1544)-g, cdbSNP:370449852
complement(1551)-t, gdbSNP:201977118
complement(1555)-g, adbSNP:377135913
complement(1569)-g, adbSNP:17847328
complement(1590)-, gdbSNP:35411045
complement(1607)-t, cdbSNP:373156842
complement(1609)-g, cdbSNP:142705655
complement(1641)-t, cdbSNP:372873338
complement(1663)-g, cdbSNP:369453748
complement(1673)-g, adbSNP:200072882
complement(1703)-g, adbSNP:149291080
complement(1705)-t, cdbSNP:35263016
complement(1720)-g, adbSNP:377306571
complement(1728)-g, cdbSNP:141235151
complement(1736)-t, cdbSNP:62427100
complement(1742)-g, cdbSNP:374462557
complement(1748)-g, adbSNP:368929894
complement(1754)-c, adbSNP:201057231
complement(1774)-g, adbSNP:200573380
1775+a, gdbSNP:17847330
complement(1789)-t, adbSNP:371698312
complement(1801)-t, gdbSNP:147054773
complement(1805)-g, adbSNP:200036472
complement(1830)-c, adbSNP:141627165
complement(1838)-g, cdbSNP:147885532
complement(1870)-t, cdbSNP:374631467
complement(1913)-t, adbSNP:138688804
complement(1986)-t, gdbSNP:372153249
complement(2012)-t, gdbSNP:200257642
complement(2022)-g, cdbSNP:201957325
complement(2024)-t, cdbSNP:72546304
complement(2027)-g, adbSNP:145034248
complement(2033)-t, gdbSNP:145386261
complement(2036)-t, gdbSNP:150039945
complement(2038)-g, adbSNP:149400255
complement(2060)-c, adbSNP:17847331
complement(2089)-t, cdbSNP:373757589
complement(2117)-t, gdbSNP:370253986
complement(2155)-t, gdbSNP:374421447
complement(2160..2161)-, gdbSNP:35716705
complement(2218)-t, gdbSNP:36087014
complement(2255)-t, cdbSNP:370394316
complement(2306)-t, cdbSNP:146546302
complement(2372)-g, adbSNP:150413533
complement(2403)-t, cdbSNP:3544
complement(2420..2422)-, tctdbSNP:112027877
complement(2493)-t, cdbSNP:373528883
complement(2647)-g, adbSNP:140595869
2767+a, gdbSNP:1804733
complement(2795)-t, gdbSNP:151333282
complement(2846..2847)-, adbSNP:376801986
complement(2890)-t, cdbSNP:142469019
complement(2960)-c, adbSNP:200779763
complement(2962..2963)-, tdbSNP:397747580
complement(2976..2977)-, tdbSNP:35981443
complement(3013)-t, cdbSNP:373423492
complement(3047)-c, adbSNP:373013057
3131+g, tdbSNP:11556960
3363+a, gdbSNP:1049846
3403+a, gdbSNP:12417
Gene SymbolPLAGL1
Gene SynonymLOT1; ZAC; ZAC1
Chromosome6
Locus Map6q24-q25
Title ZAC1 and SSTR2 are downregulated in non-functioning pituitary adenomas but not in somatotropinomas .
Author Vieria Neto L, Wildemberg LE, Colli LM, Kasuki L, Marques NV, Moraes AB, Gasparetto EL, Takiya CM, Castro M and Gadelha MR.
Journal PLoS ONE 8 (10), E77406 (2013)
Title Methylation status of imprinted genes DLK1-GTL2, MEST (PEG1), ZAC (PLAGL1), and LINE-1 elements in spermatozoa of normozoospermic men, unlike H19 imprinting control regions, is not associated with idiopathic recurrent spontaneous miscarriages .
Author Ankolkar M, Salvi V, Warke H, Vundinti BR and Balasinor NH.
Journal Fertil. Steril. 99 (6), 1668-1673 (2013)
Title Imprinting at the PLAGL1 domain is contained within a 70-kb CTCF/cohesin-mediated non-allelic chromatin loop .
Author Iglesias-Platas I, Court F, Camprubi C, Sparago A, Guillaumet-Adkins A, Martin-Trujillo A, Riccio A, Moore GE and Monk D.
Journal Nucleic Acids Res. 41 (4), 2171-2179 (2013)
Title Expression of KCNQ1OT1, CDKN1C, H19, and PLAGL1 and the methylation patterns at the KvDMR1 and H19/IGF2 imprinting control regions is conserved between human and bovine .
Author Robbins KM, Chen Z, Wells KD and Rivera RM.
Journal J. Biomed. Sci. 19, 95 (2012)
Title Tissue-specific imprinting of the ZAC/PLAGL1 tumour suppressor gene results from variable utilization of monoallelic and biallelic promoters .
Author Valleley EM, Cordery SF and Bonthron DT.
Journal Hum. Mol. Genet. 16 (8), 972-981 (2007)
Title The cell cycle control gene ZAC/PLAGL1 is imprinted--a strong candidate gene for transient neonatal diabetes .
Author Kamiya M, Judson H, Okazaki Y, Kusakabe M, Muramatsu M, Takada S, Takagi N, Arima T, Wake N, Kamimura K, Satomura K, Hermann R, Bonthron DT and Hayashizaki Y.
Journal Hum. Mol. Genet. 9 (3), 453-460 (2000)
Title Regulation of apoptosis and cell cycle arrest by Zac1, a novel zinc finger protein expressed in the pituitary gland and the brain .
Author Spengler D, Villalba M, Hoffmann A, Pantaloni C, Houssami S, Bockaert J and Journot L.
Journal EMBO J. 16 (10), 2814-2825 (1997)
Title Identification of a gene containing zinc-finger motifs based on lost expression in malignantly transformed rat ovarian surface epithelial cells .
Author Abdollahi A, Godwin AK, Miller PD, Getts LA, Schultz DC, Taguchi T, Testa JR and Hamilton TC.
Journal Cancer Res. 57 (10), 2029-2034 (1997)
Title Identification of a zinc-finger gene at 6q25: a chromosomal region implicated in development of many solid tumors .
Author Abdollahi A, Roberts D, Godwin AK, Schultz DC, Sonoda G, Testa JR and Hamilton TC.
Journal Oncogene 14 (16), 1973-1979 (1997)
Title Diabetes Mellitus, 6q24-Related Transient Neonatal .
Author Temple,I.K., Mackay,D.J.G. and Docherty,L.E.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.