• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens solute carrier family 20 (phosphate transporter), member 2 (SLC20A2), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu42143 Homo sapiens solute carrier family 20 (phosphate transporter), member 2 (SLC20A2), transcript variant 2, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu42143C Homo sapiens solute carrier family 20 (phosphate transporter), member 2 (SLC20A2), transcript variant 2, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_006749.4, 380503860
Length 1959 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens solute carrier family 20 (phosphate transporter), member 2 (SLC20A2), transcript variant 2, mRNA.
Product sodium-dependent phosphate transporter 2
Comment

Summary: This gene encodes a member of the inorganic phosphate transporter family. The encoded protein is a type 3 sodium-dependent phosphate symporter that plays an important role in phosphate homeostasis by mediating cellular phosphate uptake. The encoded protein also confers susceptibility to viral infection as a gamma-retroviral receptor. Mutations in this gene may play a role in familial idiopathic basal ganglia calcification. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012].


Transcript Variant: This variant (2) differs in the 5' UTR compared to variant 1. Variants 1, 2 and 3 encode the same protein.

RefSeq NP_006740.1
CDS 658..2616
Misc Feature(1)505..507
Misc Feature(2)673..735
Misc Feature(3)673..735
Misc Feature(4)727..>1350
Misc Feature(5)796..858
Misc Feature(6)916..978
Misc Feature(7)985..1047
Misc Feature(8)1084..1146
Misc Feature(9)1228..1290
Misc Feature(10)1297..1359
Misc Feature(11)1414..1416
Misc Feature(12)1423..1425
Misc Feature(13)1432..1434
Misc Feature(14)1438..1440
Misc Feature(15)1459..1461
Misc Feature(16)1786..1788
Misc Feature(17)<2104..2568
Misc Feature(18)2104..2166
Misc Feature(19)2248..2310
Misc Feature(20)2371..2415
Misc Feature(21)2437..2484
Misc Feature(22)2521..2583
Exon (1)1..393
Gene:SLC20A2
Gene Synonym:GLVR-2; GLVR2; IBGC1; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Exon (2)394..946
Gene:SLC20A2
Gene Synonym:GLVR-2; GLVR2; IBGC1; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Exon (3)947..1087
Gene:SLC20A2
Gene Synonym:GLVR-2; GLVR2; IBGC1; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Exon (4)1088..1173
Gene:SLC20A2
Gene Synonym:GLVR-2; GLVR2; IBGC1; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Exon (5)1174..1270
Gene:SLC20A2
Gene Synonym:GLVR-2; GLVR2; IBGC1; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Exon (6)1271..1387
Gene:SLC20A2
Gene Synonym:GLVR-2; GLVR2; IBGC1; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Exon (7)1388..1591
Gene:SLC20A2
Gene Synonym:GLVR-2; GLVR2; IBGC1; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Exon (8)1592..2180
Gene:SLC20A2
Gene Synonym:GLVR-2; GLVR2; IBGC1; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Exon (9)2181..2366
Gene:SLC20A2
Gene Synonym:GLVR-2; GLVR2; IBGC1; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Exon (10)2367..2451
Gene:SLC20A2
Gene Synonym:GLVR-2; GLVR2; IBGC1; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Exon (11)2452..3957
Gene:SLC20A2
Gene Synonym:GLVR-2; GLVR2; IBGC1; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Translation MAMDEYLWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETTGSV LLGAKVGETIRKGIIDVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVG STIGFSLVAIGTKGVQWMELVKIVASWFISPLLSGFMSGLLFVLIRIFILKKEDPVPNGL RALPVFYAATIAINVFSIMYTGAPVLGLVLPMWAIALISFGVALLFAFFVWLFVCPWMRR KITGKLQKEGALSRVSDESLSKVQEAESPVFKELPGAKANDDSTIPLTGAAGETLGTSEG TSAGSHPRAAYGRALSMTHGSVKSPISNGTFGFDGHTRSDGHVYHTVHKDSGLYKDLLHK IHIDRGPEEKPAQESNYRLLRRNNSYTCYTAAICGLPVHATFRAADSSAPEDSEKLVGDT VSYSKKRLRYDSYSSYCNAVAEAEIEAEEGGVEMKLASELADPDQPREDPAEEEKEEKDA PEVHLLFHFLQVLTACFGSFAHGGNDVSNAIGPLVALWLIYKQGGVTQEAATPVWLLFYG GVGICTGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAFTVVIASNIGLPVSTTHCKVG SVVAVGWIRSRKAVDWRLFRNIFVAWFVTVPVAGLFSAAVMALLMYGILPYV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(18)-dbSNP:
complement(18)-g, cdbSNP:367803643
complement(66)-g, adbSNP:145711927
complement(110)-t, cdbSNP:113509094
complement(124)-t, adbSNP:113755761
complement(244)-t, gdbSNP:368027645
complement(353)-t, cdbSNP:2923444
complement(359)-t, adbSNP:370986676
complement(407..408)-dbSNP:
complement(407..408)-, cdbSNP:34766727
complement(569)-t, cdbSNP:185590768
641+a, gdbSNP:2293988
complement(647)-g, adbSNP:376524648
complement(688)-t, gdbSNP:201836672
complement(715)-g, adbSNP:115993270
complement(764)-g, adbSNP:267601932
complement(795)-t, cdbSNP:116068659
complement(808)-c, adbSNP:374432419
complement(827)-g, adbSNP:370097341
complement(835)-t, cdbSNP:368076501
complement(839)-g, adbSNP:141087152
complement(843)-t, cdbSNP:201586836
complement(868)-g, adbSNP:373139157
complement(870)-g, cdbSNP:371590674
complement(875)-c, adbSNP:200620922
complement(903)-t, cdbSNP:191315561
complement(906)-t, cdbSNP:376930349
complement(918)-g, adbSNP:373120694
complement(952)-dbSNP:
complement(952)-t, cdbSNP:149761291
complement(972)-c, adbSNP:368931698
complement(1002)-g, adbSNP:34124953
complement(1008)-g, adbSNP:151060631
complement(1009)-t, adbSNP:62508043
1165+dbSNP:
1165+, tdbSNP:398122395
complement(1186)-dbSNP:
complement(1186)-g, adbSNP:267601931
complement(1190)-t, cdbSNP:142888552
complement(1199)-t, cdbSNP:140059610
complement(1209)-t, cdbSNP:114262680
complement(1210)-g, cdbSNP:188325552
1240..1241+, gtdbSNP:398122397
complement(1253)-g, adbSNP:147501705
complement(1260)-t, cdbSNP:375338138
complement(1272)-dbSNP:
complement(1272)-c, adbSNP:377458693
complement(1276)-t, cdbSNP:200363169
complement(1335)-g, adbSNP:116687117
complement(1336)-t, cdbSNP:140978915
complement(1344)-g, adbSNP:144390898
complement(1355)-g, adbSNP:111879775
complement(1356)-g, adbSNP:149457553
complement(1373)-t, cdbSNP:137953282
complement(1407)-dbSNP:
complement(1407)-c, adbSNP:369508231
complement(1418)-t, cdbSNP:138816265
complement(1428)-g, adbSNP:376751920
complement(1429)-t, cdbSNP:372351259
complement(1434)-g, cdbSNP:369833460
complement(1444)-t, cdbSNP:369823081
complement(1482)-t, cdbSNP:141670800
complement(1503)-g, adbSNP:116122164
complement(1506)-g, adbSNP:114218633
complement(1515)-t, cdbSNP:113803667
complement(1532)-t, cdbSNP:189519979
complement(1549)-g, adbSNP:201448246
complement(1550)-g, adbSNP:115932374
complement(1562)-g, adbSNP:371279197
complement(1565)-g, adbSNP:200267443
complement(1566)-t, cdbSNP:75248974
complement(1567)-t, cdbSNP:73675069
complement(1567)-g, adbSNP:386451045
complement(1587)-t, gdbSNP:200452987
complement(1590)-g, adbSNP:115902470
complement(1638)-dbSNP:
complement(1638)-g, adbSNP:372443583
complement(1642)-c, adbSNP:115961682
complement(1644)-g, adbSNP:149134052
complement(1657)-t, cdbSNP:369778536
complement(1665)-g, adbSNP:111553899
complement(1668)-t, gdbSNP:116359869
complement(1677)-g, adbSNP:141611151
complement(1686)-t, cdbSNP:200204025
complement(1709)-g, adbSNP:375616455
complement(1710)-t, cdbSNP:371423675
complement(1728)-g, cdbSNP:371913318
complement(1758)-g, cdbSNP:199935692
complement(1767)-t, cdbSNP:147905358
complement(1791)-c, adbSNP:114636687
complement(1794)-t, cdbSNP:140966410
complement(1802)-t, cdbSNP:200010919
complement(1833)-g, adbSNP:377708700
complement(1855)-t, cdbSNP:116194858
complement(1872)-t, cdbSNP:201993727
complement(1911)-g, adbSNP:115234947
complement(1938)-t, cdbSNP:148397659
complement(1939)-g, adbSNP:199804961
complement(1995)-g, cdbSNP:374973821
complement(2011)-c, adbSNP:370095133
complement(2026)-t, cdbSNP:201148539
complement(2027)-g, adbSNP:372750318
complement(2034)-c, adbSNP:144428935
complement(2062)-t, cdbSNP:141548800
complement(2079)-c, adbSNP:369424739
complement(2087)-t, cdbSNP:373069060
complement(2095)-t, cdbSNP:79577461
complement(2121)-g, adbSNP:200628725
complement(2139)-g, adbSNP:114554453
complement(2154)-t, gdbSNP:201469305
complement(2175)-g, adbSNP:369952980
complement(2187)-dbSNP:
complement(2187)-g, adbSNP:267601930
complement(2229)-g, adbSNP:116795654
complement(2230)-t, cdbSNP:112198681
complement(2237)-g, adbSNP:145970823
complement(2244)-t, cdbSNP:142560741
complement(2252)-g, adbSNP:138052637
complement(2292)-g, adbSNP:367991545
complement(2298)-g, adbSNP:200469528
complement(2325)-g, cdbSNP:377123419
complement(2361)-t, cdbSNP:372331061
complement(2367)-dbSNP:
complement(2367)-g, adbSNP:370590168
2380+a, gdbSNP:387906653
complement(2419)-t, cdbSNP:201815306
complement(2421)-g, adbSNP:200195309
2441+c, tdbSNP:387906654
complement(2442)-t, cdbSNP:375928733
2459+dbSNP:
2459+c, g, tdbSNP:387906652
complement(2469)-g, adbSNP:116401889
complement(2482)-g, adbSNP:200340427
2485..2488+, tcccdbSNP:398122396
complement(2507)-t, cdbSNP:376447185
complement(2538)-g, adbSNP:201829908
complement(2539)-t, cdbSNP:200761348
complement(2545)-t, cdbSNP:148276686
complement(2554)-c, adbSNP:147025172
complement(2568)-g, adbSNP:141545390
complement(2591)-t, adbSNP:115580154
complement(2626)-g, adbSNP:369323964
complement(2637)-t, cdbSNP:376749319
complement(2650)-t, cdbSNP:111446505
complement(2686)-g, adbSNP:371247567
complement(2728)-c, adbSNP:114729286
complement(2729)-t, adbSNP:115989387
complement(2840)-t, cdbSNP:182867314
2849+c, tdbSNP:148887343
complement(2879)-t, gdbSNP:145543019
complement(2924)-t, cdbSNP:146158993
2951+a, tdbSNP:1803658
2977+a, gdbSNP:3763510
complement(2992)-t, cdbSNP:142241660
complement(2995)-g, adbSNP:112583562
complement(2996)-g, adbSNP:72643203
complement(3025)-t, cdbSNP:190717111
complement(3050)-g, adbSNP:185564375
3186+g, tdbSNP:1803657
complement(3226..3228)-, aatdbSNP:369681447
3673+c, gdbSNP:6841
complement(3906)-g, adbSNP:372827268
Gene SymbolSLC20A2
Gene SynonymGLVR-2; GLVR2; IBGC1; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Chromosome8
Locus Map8p11.21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006749 Homo sapiens solute carrier family 20 (phosphate transporter), member 2 (SLC20A2), transcript variant 2, mRNA. On-demand $219.00 7-9
NM_001257180 Homo sapiens solute carrier family 20 (phosphate transporter), member 2 (SLC20A2), transcript variant 1, mRNA. On-demand $219.00 7-9
NM_001257181 Homo sapiens solute carrier family 20 (phosphate transporter), member 2 (SLC20A2), transcript variant 3, mRNA. On-demand $219.00 7-9
XM_005273613 PREDICTED: Homo sapiens solute carrier family 20 (phosphate transporter), member 2 (SLC20A2), transcript variant X1, mRNA. On-demand $219.00 7-9
XM_005273615 PREDICTED: Homo sapiens solute carrier family 20 (phosphate transporter), member 2 (SLC20A2), transcript variant X3, mRNA. On-demand $219.00 7-9
XM_006716390 PREDICTED: Homo sapiens solute carrier family 20 (phosphate transporter), member 2 (SLC20A2), transcript variant X4, mRNA. On-demand $219.00 7-9
XM_006716391 PREDICTED: Homo sapiens solute carrier family 20 (phosphate transporter), member 2 (SLC20A2), transcript variant X5, mRNA. On-demand $219.00 7-9
Title Evaluation of SLC20A2 mutations that cause idiopathic basal ganglia calcification in Japan .
Author Yamada M, Tanaka M, Takagi M, Kobayashi S, Taguchi Y, Takashima S, Tanaka K, Touge T, Hatsuta H, Murayama S, Hayashi Y, Kaneko M, Ishiura H, Mitsui J, Atsuta N, Sobue G, Shimozawa N, Inuzuka T, Tsuji S and Hozumi I.
Journal Neurology 82 (8), 705-712 (2014)
Title Phenotypic spectrum of probable and genetically-confirmed idiopathic basal ganglia calcification .
Author Nicolas G, Pottier C, Charbonnier C, Guyant-Marechal L, Le Ber I, Pariente J, Labauge P, Ayrignac X, Defebvre L, Maltete D, Martinaud O, Lefaucheur R, Guillin O, Wallon D, Chaumette B, Rondepierre P, Derache N, Fromager G, Schaeffer S, Krystkowiak P, Verny C, Jurici S, Sauvee M, Verin M, Lebouvier T, Rouaud O, Thauvin-Robinet C, Rousseau S, Rovelet-Lecrux A, Frebourg T, Campion D and Hannequin D.
Journal Brain 136 (PT 11), 3395-3407 (2013)
Title Novel SLC20A2 mutations identified in southern Chinese patients with idiopathic basal ganglia calcification .
Author Chen WJ, Yao XP, Zhang QJ, Ni W, He J, Li HF, Liu XY, Zhao GX, Murong SX, Wang N and Wu ZY.
Journal Gene 529 (1), 159-162 (2013)
Title Mutations in SLC20A2 link familial idiopathic basal ganglia calcification with phosphate homeostasis .
Author Wang C, Li Y, Shi L, Ren J, Patti M, Wang T, de Oliveira JR, Sobrido MJ, Quintans B, Baquero M, Cui X, Zhang XY, Wang L, Xu H, Wang J, Yao J, Dai X, Liu J, Zhang L, Ma H, Gao Y, Ma X, Feng S, Liu M, Wang QK, Forster IC, Zhang X and Liu JY.
Journal Nat. Genet. 44 (3), 254-256 (2012)
Title The envelope glycoprotein of an amphotropic murine retrovirus binds specifically to the cellular receptor/phosphate transporter of susceptible species .
Author Kozak SL, Siess DC, Kavanaugh MP, Miller AD and Kabat D.
Journal J. Virol. 69 (6), 3433-3440 (1995)
Title A family of retroviruses that utilize related phosphate transporters for cell entry .
Author Miller DG and Miller AD.
Journal J. Virol. 68 (12), 8270-8276 (1994)
Title Cell-surface receptors for gibbon ape leukemia virus and amphotropic murine retrovirus are inducible sodium-dependent phosphate symporters .
Author Kavanaugh MP, Miller DG, Zhang W, Law W, Kozak SL, Kabat D and Miller AD.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (15), 7071-7075 (1994)
Title A human amphotropic retrovirus receptor is a second member of the gibbon ape leukemia virus receptor family .
Author van Zeijl M, Johann SV, Closs E, Cunningham J, Eddy R, Shows TB and O'Hara B.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (3), 1168-1172 (1994)
Title Primary Familial Brain Calcification .
Author Sobrido,M.J., Coppola,G., Oliveira,J., Hopfer,S. and Geschwind,D.H.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Localization of the amphotropic murine leukemia virus receptor gene to the pericentromeric region of human chromosome 8 .
Author Garcia JV, Jones C and Miller AD.
Journal J. Virol. 65 (11), 6316-6319 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.