• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens solute carrier family 20 (phosphate transporter), member 2 (SLC20A2), transcript variant 2, mRNA.


RefSeq Accession Definition Services Price Order
NM_006749 Homo sapiens solute carrier family 20 (phosphate transporter), member 2 (SLC20A2), transcript variant 2, mRNA. ORF Sequence $568.11
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_006749.4, 380503860
Length 3971 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens solute carrier family 20 (phosphate transporter), member 2 (SLC20A2), transcript variant 2, mRNA.
Product sodium-dependent phosphate transporter 2
Comment

Summary: This gene encodes a member of the inorganic phosphate transporter family. The encoded protein is a type 3 sodium-dependent phosphate symporter that plays an important role in phosphate homeostasis by mediating cellular phosphate uptake. The encoded protein also confers susceptibility to viral infection as a gamma-retroviral receptor. Mutations in this gene may play a role in familial idiopathic basal ganglia calcification. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012].


Transcript Variant: This variant (2) differs in the 5' UTR compared to variant 1. Variants 1, 2 and 3 encode the same protein.

RefSeq NP_006740.1
CDS 658..2616
Misc Feature(1)505..507
Misc Feature(2)673..735
Misc Feature(3)673..735
Misc Feature(4)727..>1308
Misc Feature(5)796..858
Misc Feature(6)916..978
Misc Feature(7)985..1047
Misc Feature(8)1084..1146
Misc Feature(9)1228..1290
Misc Feature(10)1297..1359
Misc Feature(11)1414..1416
Misc Feature(12)1423..1425
Misc Feature(13)1432..1434
Misc Feature(14)1438..1440
Misc Feature(15)1459..1461
Misc Feature(16)1786..1788
Misc Feature(17)<2104..2568
Misc Feature(18)2104..2166
Misc Feature(19)2248..2310
Misc Feature(20)2371..2415
Misc Feature(21)2437..2484
Misc Feature(22)2521..2583
Exon (1)1..393
Gene:SLC20A2
Gene Synonym:GLVR-2; GLVR2; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Exon (2)394..946
Gene:SLC20A2
Gene Synonym:GLVR-2; GLVR2; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Exon (3)947..1087
Gene:SLC20A2
Gene Synonym:GLVR-2; GLVR2; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Exon (4)1088..1173
Gene:SLC20A2
Gene Synonym:GLVR-2; GLVR2; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Exon (5)1174..1270
Gene:SLC20A2
Gene Synonym:GLVR-2; GLVR2; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Exon (6)1271..1387
Gene:SLC20A2
Gene Synonym:GLVR-2; GLVR2; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Exon (7)1388..1591
Gene:SLC20A2
Gene Synonym:GLVR-2; GLVR2; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Exon (8)1592..2180
Gene:SLC20A2
Gene Synonym:GLVR-2; GLVR2; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Exon (9)2181..2366
Gene:SLC20A2
Gene Synonym:GLVR-2; GLVR2; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Exon (10)2367..2451
Gene:SLC20A2
Gene Synonym:GLVR-2; GLVR2; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Exon (11)2452..3957
Gene:SLC20A2
Gene Synonym:GLVR-2; GLVR2; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Translation MAMDEYLWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETTGSV LLGAKVGETIRKGIIDVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVG STIGFSLVAIGTKGVQWMELVKIVASWFISPLLSGFMSGLLFVLIRIFILKKEDPVPNGL RALPVFYAATIAINVFSIMYTGAPVLGLVLPMWAIALISFGVALLFAFFVWLFVCPWMRR KITGKLQKEGALSRVSDESLSKVQEAESPVFKELPGAKANDDSTIPLTGAAGETLGTSEG TSAGSHPRAAYGRALSMTHGSVKSPISNGTFGFDGHTRSDGHVYHTVHKDSGLYKDLLHK IHIDRGPEEKPAQESNYRLLRRNNSYTCYTAAICGLPVHATFRAADSSAPEDSEKLVGDT VSYSKKRLRYDSYSSYCNAVAEAEIEAEEGGVEMKLASELADPDQPREDPAEEEKEEKDA PEVHLLFHFLQVLTACFGSFAHGGNDVSNAIGPLVALWLIYKQGGVTQEAATPVWLLFYG GVGICTGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAFTVVIASNIGLPVSTTHCKVG SVVAVGWIRSRKAVDWRLFRNIFVAWFVTVPVAGLFSAAVMALLMYGILPYV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(66)-dbSNP:
complement(66)-g, adbSNP:145711927
complement(110)-t, cdbSNP:113509094
complement(124)-t, adbSNP:113755761
complement(353)-t, cdbSNP:2923444
complement(407..408)-dbSNP:
complement(407..408)-, cdbSNP:34766727
complement(569)-t, cdbSNP:185590768
complement(641)-g, adbSNP:2293988
complement(688)-t, gdbSNP:201836672
complement(715)-g, adbSNP:115993270
complement(795)-t, cdbSNP:116068659
complement(839)-g, adbSNP:141087152
complement(843)-t, cdbSNP:201586836
complement(875)-c, adbSNP:200620922
complement(903)-t, cdbSNP:191315561
complement(905)-g, adbSNP:145108472
complement(952)-dbSNP:
complement(952)-t, cdbSNP:149761291
complement(1002)-g, adbSNP:34124953
complement(1008)-g, adbSNP:151060631
complement(1009)-t, adbSNP:62508043
complement(1190)-dbSNP:
complement(1190)-t, cdbSNP:142888552
complement(1199)-t, cdbSNP:140059610
complement(1209)-t, cdbSNP:114262680
complement(1210)-g, cdbSNP:188325552
complement(1253)-g, adbSNP:147501705
complement(1276)-dbSNP:
complement(1276)-t, cdbSNP:200363169
complement(1277)-c, adbSNP:144836155
complement(1335)-g, adbSNP:116687117
complement(1336)-t, cdbSNP:140978915
complement(1344)-g, adbSNP:144390898
complement(1355)-g, adbSNP:111879775
complement(1356)-g, adbSNP:149457553
complement(1373)-t, cdbSNP:137953282
complement(1418)-dbSNP:
complement(1418)-t, cdbSNP:138816265
complement(1482)-t, cdbSNP:141670800
complement(1503)-g, adbSNP:116122164
complement(1506)-g, adbSNP:114218633
complement(1515)-t, cdbSNP:113803667
complement(1532)-t, cdbSNP:189519979
complement(1549)-g, adbSNP:201448246
complement(1550)-g, adbSNP:115932374
complement(1565)-g, adbSNP:200267443
complement(1566)-t, cdbSNP:75248974
complement(1567)-t, cdbSNP:73675069
complement(1587)-t, gdbSNP:200452987
complement(1590)-g, adbSNP:115902470
complement(1642)-dbSNP:
complement(1642)-c, adbSNP:115961682
complement(1644)-g, adbSNP:149134052
complement(1665)-g, adbSNP:111553899
complement(1668)-t, gdbSNP:116359869
complement(1677)-g, adbSNP:141611151
complement(1686)-t, cdbSNP:200204025
complement(1758)-g, cdbSNP:199935692
complement(1767)-t, cdbSNP:147905358
complement(1791)-c, adbSNP:114636687
complement(1794)-t, cdbSNP:140966410
complement(1802)-t, cdbSNP:200010919
complement(1855)-t, cdbSNP:116194858
complement(1872)-t, cdbSNP:201993727
complement(1911)-g, adbSNP:115234947
complement(1938)-t, cdbSNP:148397659
complement(1939)-g, adbSNP:199804961
complement(2026)-t, cdbSNP:201148539
complement(2034)-c, adbSNP:144428935
complement(2062)-t, cdbSNP:141548800
complement(2095)-t, cdbSNP:79577461
complement(2121)-g, adbSNP:200628725
complement(2139)-g, adbSNP:114554453
complement(2154)-t, gdbSNP:201469305
complement(2229)-dbSNP:
complement(2229)-g, adbSNP:116795654
complement(2230)-t, cdbSNP:112198681
complement(2237)-g, adbSNP:145970823
complement(2244)-t, cdbSNP:142560741
complement(2252)-g, adbSNP:138052637
complement(2298)-g, adbSNP:200469528
complement(2419)-dbSNP:
complement(2419)-t, cdbSNP:201815306
complement(2421)-g, adbSNP:200195309
complement(2460)-dbSNP:
complement(2460)-t, cdbSNP:150370386
complement(2469)-g, adbSNP:116401889
complement(2482)-g, adbSNP:200340427
complement(2538)-g, adbSNP:201829908
complement(2539)-t, cdbSNP:200761348
complement(2545)-t, cdbSNP:148276686
complement(2554)-c, adbSNP:147025172
complement(2568)-g, adbSNP:141545390
complement(2591)-t, adbSNP:115580154
complement(2650)-t, cdbSNP:111446505
complement(2728)-c, adbSNP:114729286
complement(2729)-t, adbSNP:115989387
complement(2840)-t, cdbSNP:182867314
complement(2849)-t, cdbSNP:148887343
complement(2879)-t, gdbSNP:145543019
complement(2924)-t, cdbSNP:146158993
complement(2951)-t, adbSNP:1803658
complement(2977)-g, adbSNP:3763510
complement(2992)-t, cdbSNP:142241660
complement(2995)-g, adbSNP:112583562
complement(2996)-g, adbSNP:72643203
complement(3025)-t, cdbSNP:190717111
complement(3050)-g, adbSNP:185564375
complement(3186)-t, gdbSNP:1803657
complement(3673)-g, cdbSNP:6841
Gene SymbolSLC20A2
Gene SynonymGLVR-2; GLVR2; IBGC3; MLVAR; PIT-2; PIT2; RAM1
Chromosome8
Locus Map8p11.21
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001257180 Homo sapiens solute carrier family 20 (phosphate transporter), member 2 (SLC20A2), transcript variant 1, mRNA. Full Length $1402.80
ORF Sequence $568.11
NM_001257181 Homo sapiens solute carrier family 20 (phosphate transporter), member 2 (SLC20A2), transcript variant 3, mRNA. Full Length $1273.65
ORF Sequence $568.11
NM_006749 Homo sapiens solute carrier family 20 (phosphate transporter), member 2 (SLC20A2), transcript variant 2, mRNA. Full Length $1389.85
ORF Sequence $568.11
Title Genetics in arterial calcification: lessons learned from rare diseases .
Author Nitschke,Y. and Rutsch,F.
Journal Trends Cardiovasc. Med. 22 (6), 145-149 (2012)
Title Mutations in SLC20A2 link familial idiopathic basal ganglia calcification with phosphate homeostasis .
Author Wang,C., Li,Y., Shi,L., Ren,J., Patti,M., Wang,T., de Oliveira,J.R., Sobrido,M.J., Quintans,B., Baquero,M., Cui,X., Zhang,X.Y., Wang,L., Xu,H., Wang,J., Yao,J., Dai,X., Liu,J., Zhang,L., Ma,H., Gao,Y., Ma,X., Feng,S., Liu,M., Wang,Q.K., Forster,I.C., Zhang,X. and Liu,J.Y.
Journal Nat. Genet. 44 (3), 254-256 (2012)
Title Mapping of the minimal inorganic phosphate transporting unit of human PiT2 suggests a structure universal to PiT-related proteins from all kingdoms of life .
Author Bottger,P. and Pedersen,L.
Journal BMC Biochem. 12, 21 (2011)
Title Deciphering PiT transport kinetics and substrate specificity using electrophysiology and flux measurements .
Author Ravera,S., Virkki,L.V., Murer,H. and Forster,I.C.
Journal Am. J. Physiol., Cell Physiol. 293 (2), C606-C620 (2007)
Title Characterization of transport mechanisms and determinants critical for Na+-dependent Pi symport of the PiT family paralogs human PiT1 and PiT2 .
Author Bottger,P., Hede,S.E., Grunnet,M., Hoyer,B., Klaerke,D.A. and Pedersen,L.
Journal Am. J. Physiol., Cell Physiol. 291 (6), C1377-C1387 (2006)
Title The envelope glycoprotein of an amphotropic murine retrovirus binds specifically to the cellular receptor/phosphate transporter of susceptible species .
Author Kozak,S.L., Siess,D.C., Kavanaugh,M.P., Miller,A.D. and Kabat,D.
Journal J. Virol. 69 (6), 3433-3440 (1995)
Title A family of retroviruses that utilize related phosphate transporters for cell entry .
Author Miller,D.G. and Miller,A.D.
Journal J. Virol. 68 (12), 8270-8276 (1994)
Title Cell-surface receptors for gibbon ape leukemia virus and amphotropic murine retrovirus are inducible sodium-dependent phosphate symporters .
Author Kavanaugh,M.P., Miller,D.G., Zhang,W., Law,W., Kozak,S.L., Kabat,D. and Miller,A.D.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (15), 7071-7075 (1994)
Title A human amphotropic retrovirus receptor is a second member of the gibbon ape leukemia virus receptor family .
Author van Zeijl,M., Johann,S.V., Closs,E., Cunningham,J., Eddy,R., Shows,T.B. and O'Hara,B.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (3), 1168-1172 (1994)
Title Localization of the amphotropic murine leukemia virus receptor gene to the pericentromeric region of human chromosome 8 .
Author Garcia,J.V., Jones,C. and Miller,A.D.
Journal J. Virol. 65 (11), 6316-6319 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878