• THAT   AND
  • THAT   AND


Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (YWHAQ), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_006826 Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (YWHAQ), mRNA. Full Lenth $628.14
ORF Sequence $214.02


RefSeq Version NM_006826.2, 21464103
Length 2166 bp
Structure linear
Update Date 17-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (YWHAQ), mRNA.
Product 14-3-3 protein theta
Comment

Summary: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5' UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease. [provided by RefSeq].

RefSeq NP_006817.1
CDS 120..857
Exon (1)1..37
Exon (2)1..37
Exon (3)38..413
Exon (4)414..537
Exon (5)538..701
Exon (6)702..797
Exon (7)798..2166
Translation MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA EGAEN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
52+a, cdbSNP:11544463
88+c, tdbSNP:1130874
97..98+a, cdbSNP:11544466
103..104+a, cdbSNP:11544462
109+a, cdbSNP:11544464
336+a, gdbSNP:11544465
complement(420)-g, adbSNP:112226455
complement(877)-g, adbSNP:41264177
949+c, tdbSNP:16822436
complement(1008..1009)-t, gdbSNP:16844798
complement(1026)-c, adbSNP:76429341
complement(1118)-g, adbSNP:112750534
1423+a, gdbSNP:56188084
1432+c, tdbSNP:111805094
1505+a, cdbSNP:11544459
1564+a, gdbSNP:11544460
1600+a, gdbSNP:55980816
complement(1657)-, atttadbSNP:60152522
1699+a, gdbSNP:111650853
complement(1796)-t, adbSNP:6758214
2005+a, gdbSNP:7594
Gene SymbolYWHAQ
Gene Synonym14-3-3; 1C5; HS1
Chromosome2
Locus Map2p25.1
All Transcripts NM_006826
Title Differential protein expression level identification by knockout of 14-3-3tau with siRNA technique and 2DE followed MALDI-TOF-TOF-MS .
Author Jin,H., Hu,R., Cheng,Y., Yang,F., Zhou,X., Li,X. and Yang,P.Y.
Journal Analyst 136 (2), 401-406 (2011)
Title Impaired binding of 14-3-3 to C-RAF in Noonan syndrome suggests new approaches in diseases with increased Ras signaling .
Author Molzan,M., Schumacher,B., Ottmann,C., Baljuls,A., Polzien,L., Weyand,M., Thiel,P., Rose,R., Rose,M., Kuhenne,P., Kaiser,M., Rapp,U.R., Kuhlmann,J. and Ottmann,C.
Journal Mol. Cell. Biol. 30 (19), 4698-4711 (2010)
Title The expression of seven 14-3-3 isoforms in human meningioma .
Author Liu,Y., Tian,R.F., Li,Y.M., Liu,W.P., Cao,L., Yang,X.L., Cao,W.D. and Zhang,X.
Journal Brain Res. 1336, 98-102 (2010)
Title Aurora B and 14-3-3 coordinately regulate clustering of centralspindlin during cytokinesis .
Author Douglas,M.E., Davies,T., Joseph,N. and Mishima,M.
Journal Curr. Biol. 20 (10), 927-933 (2010)
Title The PX-RICS-14-3-3zeta/theta complex couples N-cadherin-beta-catenin with dynein-dynactin to mediate its export from the endoplasmic reticulum .
Author Nakamura,T., Hayashi,T., Mimori-Kiyosue,Y., Sakaue,F., Matsuura,K., Iemura,S., Natsume,T. and Akiyama,T.
Journal J. Biol. Chem. 285 (21), 16145-16154 (2010)
Title Activation-modulated association of 14-3-3 proteins with Cbl in T cells .
Author Liu,Y.C., Elly,C., Yoshida,H., Bonnefoy-Berard,N. and Altman,A.
Journal J. Biol. Chem. 271 (24), 14591-14595 (1996)
Title Inhibition of phosphatidylinositol 3-kinase activity by association with 14-3-3 proteins in T cells .
Author Bonnefoy-Berard,N., Liu,Y.C., von Willebrand,M., Sung,A., Elly,C., Mustelin,T., Yoshida,H., Ishizaka,K. and Altman,A.
Journal Proc. Natl. Acad. Sci. U.S.A. 92 (22), 10142-10146 (1995)
Title Structure of a 14-3-3 protein and implications for coordination of multiple signalling pathways .
Author Xiao,B., Smerdon,S.J., Jones,D.H., Dodson,G.G., Soneji,Y., Aitken,A. and Gamblin,S.J.
Journal Nature 376 (6536), 188-191 (1995)
Title Molecular cloning and expression of the transformation sensitive epithelial marker stratifin. A member of a protein family that has been involved in the protein kinase C signalling pathway .
Author Leffers,H., Madsen,P., Rasmussen,H.H., Honore,B., Andersen,A.H., Walbum,E., Vandekerckhove,J. and Celis,J.E.
Journal J. Mol. Biol. 231 (4), 982-998 (1993)
Title Primary structure of a human protein kinase regulator protein .
Author Nielsen,P.J.
Journal Biochim. Biophys. Acta 1088 (3), 425-428 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878