• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta (YWHAQ), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu16909 Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta (YWHAQ), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu16909C Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta (YWHAQ), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_006826.3, 514052668
Length 738 bp
Structure linear
Update Date 20-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta (YWHAQ), mRNA.
Product 14-3-3 protein theta
Comment

Summary: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5' UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease. [provided by RefSeq, Jul 2008].

RefSeq NP_006817.1
CDS 198..935
Misc Feature(1)111..113
Misc Feature(2)198..899
Misc Feature(3)198..899
Misc Feature(4)198..200
Misc Feature(5)204..206
Misc Feature(6)order(219..224,234..236,240..245,249..251,258..260,
Misc Feature(7)270..272
Misc Feature(8)order(342..344,363..365,555..557,576..581,702..704,
Misc Feature(9)342..344
Misc Feature(10)363..365
Misc Feature(11)399..401
Misc Feature(12)540..542
Misc Feature(13)576..578
Misc Feature(14)885..887
Misc Feature(15)891..893
Misc Feature(16)891..893
Misc Feature(17)891..893
Exon (1)1..115
Gene:YWHAQ
Gene Synonym:14-3-3; 1C5; HS1
Exon (2)116..491
Gene:YWHAQ
Gene Synonym:14-3-3; 1C5; HS1
Exon (3)492..615
Gene:YWHAQ
Gene Synonym:14-3-3; 1C5; HS1
Exon (4)616..779
Gene:YWHAQ
Gene Synonym:14-3-3; 1C5; HS1
Exon (5)780..875
Gene:YWHAQ
Gene Synonym:14-3-3; 1C5; HS1
Exon (6)876..2254
Gene:YWHAQ
Gene Synonym:14-3-3; 1C5; HS1
Translation MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA EGAEN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(21)-dbSNP:
complement(21)-g, adbSNP:62119435
complement(100)-g, adbSNP:144636684
130+dbSNP:
130+a, cdbSNP:11544463
166+c, tdbSNP:1130874
complement(167)-g, adbSNP:375411374
180..181+a, cdbSNP:11544466
186..187+a, cdbSNP:11544462
187+a, cdbSNP:11544464
complement(189..190)-, cggggcdbSNP:200302461
complement(236)-g, adbSNP:368668324
complement(282)-t, cdbSNP:141887759
complement(308)-g, adbSNP:377250330
complement(314)-t, cdbSNP:372978538
complement(320)-g, adbSNP:201957113
414+a, gdbSNP:11544465
complement(416)-g, adbSNP:202138500
complement(436)-t, cdbSNP:199958721
complement(468)-t, gdbSNP:372545955
complement(474)-t, adbSNP:369852702
complement(498)-dbSNP:
complement(498)-g, adbSNP:112226455
complement(525)-t, cdbSNP:185211853
complement(651)-dbSNP:
complement(651)-c, adbSNP:371354151
complement(668)-t, cdbSNP:201487177
complement(669)-t, cdbSNP:199515928
complement(671)-t, cdbSNP:144863616
complement(693)-t, cdbSNP:200884745
complement(697)-t, cdbSNP:367832498
complement(766)-g, adbSNP:150523147
complement(781)-dbSNP:
complement(781)-g, adbSNP:377175915
complement(913)-dbSNP:
complement(913)-g, adbSNP:200376025
complement(914)-t, cdbSNP:373178591
complement(932)-g, adbSNP:148399453
complement(935)-t, cdbSNP:199737672
complement(953)-g, adbSNP:191830707
complement(954)-g, adbSNP:145097891
complement(955)-g, adbSNP:41264177
complement(956)-c, adbSNP:375784718
complement(961)-c, adbSNP:369470995
complement(982)-t, adbSNP:376453415
1027+c, tdbSNP:16822436
complement(1086..1087)-t, gdbSNP:16844798
complement(1104)-c, adbSNP:76429341
complement(1134)-g, adbSNP:374886445
complement(1196)-g, adbSNP:112750534
complement(1227)-t, adbSNP:187340849
complement(1290)-g, cdbSNP:371569671
complement(1500)-t, cdbSNP:184509644
complement(1506)-g, cdbSNP:192318359
complement(1511)-t, cdbSNP:368172501
1583+a, cdbSNP:11544459
complement(1583)-c, adbSNP:386518891
complement(1600)-t, gdbSNP:189104400
complement(1686)-g, adbSNP:182444865
complement(1731..1735)-, atttadbSNP:60152522
complement(1735..1739)-, tttaadbSNP:147701876
complement(1808)-g, adbSNP:191107303
complement(1874)-t, adbSNP:6758214
complement(2078)-t, cdbSNP:187680337
2083+a, gdbSNP:7594
Gene SymbolYWHAQ
Gene Synonym14-3-3; 1C5; HS1
Chromosome2
Locus Map2p25.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006826 Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta (YWHAQ), mRNA. In-stock $99.00 5-7
Title Identification of a novel ATPase activity in 14-3-3 proteins--evidence from enzyme kinetics, structure guided modeling and mutagenesis studies .
Author Ramteke MP, Shelke P, Ramamoorthy V, Somavarapu AK, Gautam AK, Nanaware PP, Karanam S, Mukhopadhyay S and Venkatraman P.
Journal FEBS Lett. 588 (1), 71-78 (2014)
Title 14-3-3 proteins modulate the ETS transcription factor ETV1 in prostate cancer .
Author Oh S, Shin S, Lightfoot SA and Janknecht R.
Journal Cancer Res. 73 (16), 5110-5119 (2013)
Title Negative regulation of the RalGAP complex by 14-3-3 .
Author Leto D, Uhm M, Williams A, Chen XW and Saltiel AR.
Journal J. Biol. Chem. 288 (13), 9272-9283 (2013)
Title Oligomeric structure of 14-3-3 protein: what do we know about monomers? .
Author Sluchanko NN and Gusev NB.
Journal FEBS Lett. 586 (24), 4249-4256 (2012)
Title Cerebrospinal fluid biomarker supported diagnosis of Creutzfeldt-Jakob disease and rapid dementias: a longitudinal multicentre study over 10 years .
Author Stoeck K, Sanchez-Juan P, Gawinecka J, Green A, Ladogana A, Pocchiari M, Sanchez-Valle R, Mitrova E, Sklaviadis T, Kulczycki J, Slivarichova D, Saiz A, Calero M, Knight R, Aguzzi A, Laplanche JL, Peoc'h K, Schelzke G, Karch A, van Duijn CM and Zerr I.
Journal Brain 135 (PT 10), 3051-3061 (2012)
Title Activation-modulated association of 14-3-3 proteins with Cbl in T cells .
Author Liu YC, Elly C, Yoshida H, Bonnefoy-Berard N and Altman A.
Journal J. Biol. Chem. 271 (24), 14591-14595 (1996)
Title Inhibition of phosphatidylinositol 3-kinase activity by association with 14-3-3 proteins in T cells .
Author Bonnefoy-Berard N, Liu YC, von Willebrand M, Sung A, Elly C, Mustelin T, Yoshida H, Ishizaka K and Altman A.
Journal Proc. Natl. Acad. Sci. U.S.A. 92 (22), 10142-10146 (1995)
Title Structure of a 14-3-3 protein and implications for coordination of multiple signalling pathways .
Author Xiao B, Smerdon SJ, Jones DH, Dodson GG, Soneji Y, Aitken A and Gamblin SJ.
Journal Nature 376 (6536), 188-191 (1995)
Title Molecular cloning and expression of the transformation sensitive epithelial marker stratifin. A member of a protein family that has been involved in the protein kinase C signalling pathway .
Author Leffers H, Madsen P, Rasmussen HH, Honore B, Andersen AH, Walbum E, Vandekerckhove J and Celis JE.
Journal J. Mol. Biol. 231 (4), 982-998 (1993)
Title Primary structure of a human protein kinase regulator protein .
Author Nielsen PJ.
Journal Biochim. Biophys. Acta 1088 (3), 425-428 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.