• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (YWHAQ), mRNA.


RefSeq Accession Definition Services Price Order
NM_006826 Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (YWHAQ), mRNA. ORF Sequence $214.02
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_006826.2, 21464103
Length 2166 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (YWHAQ), mRNA.
Product 14-3-3 protein theta
Comment

Summary: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5' UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease. [provided by RefSeq, Jul 2008].

RefSeq NP_006817.1
CDS 120..857
Misc Feature(1)33..35
Misc Feature(2)120..806
Misc Feature(3)120..806
Misc Feature(4)120..122
Misc Feature(5)126..128
Misc Feature(6)order(141..146,156..158,162..167,171..173,180..182,
Misc Feature(7)192..194
Misc Feature(8)order(264..266,285..287,477..479,498..503,624..626,
Misc Feature(9)264..266
Misc Feature(10)285..287
Misc Feature(11)321..323
Misc Feature(12)462..464
Misc Feature(13)498..500
Misc Feature(14)807..809
Misc Feature(15)813..815
Misc Feature(16)813..815
Misc Feature(17)813..815
Exon (1)1..37
Gene:YWHAQ
Gene Synonym:14-3-3; 1C5; HS1
Exon (2)38..413
Gene:YWHAQ
Gene Synonym:14-3-3; 1C5; HS1
Exon (3)414..537
Gene:YWHAQ
Gene Synonym:14-3-3; 1C5; HS1
Exon (4)538..701
Gene:YWHAQ
Gene Synonym:14-3-3; 1C5; HS1
Exon (5)702..797
Gene:YWHAQ
Gene Synonym:14-3-3; 1C5; HS1
Exon (6)798..2166
Gene:YWHAQ
Gene Synonym:14-3-3; 1C5; HS1
Translation MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA EGAEN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(22)-dbSNP:
complement(22)-g, adbSNP:144636684
complement(52)-dbSNP:
complement(52)-c, adbSNP:11544463
complement(88)-t, cdbSNP:1130874
complement(97..98)-c, adbSNP:11544466
complement(103..104)-c, adbSNP:11544462
complement(109)-c, adbSNP:11544464
complement(111..112)-, cggggcdbSNP:200302461
complement(204)-t, cdbSNP:141887759
complement(242)-g, adbSNP:201957113
complement(336)-g, adbSNP:11544465
complement(338)-g, adbSNP:202138500
complement(358)-t, cdbSNP:199958721
complement(420)-dbSNP:
complement(420)-g, adbSNP:112226455
complement(447)-t, cdbSNP:185211853
complement(590)-dbSNP:
complement(590)-t, cdbSNP:201487177
complement(591)-t, cdbSNP:199515928
complement(593)-t, cdbSNP:144863616
complement(615)-t, cdbSNP:200884745
complement(688)-g, adbSNP:150523147
complement(835)-dbSNP:
complement(835)-g, adbSNP:200376025
complement(854)-g, adbSNP:148399453
complement(857)-t, cdbSNP:199737672
complement(875)-g, adbSNP:191830707
complement(876)-g, adbSNP:145097891
complement(877)-g, adbSNP:41264177
complement(949)-t, cdbSNP:16822436
complement(1008..1009)-t, gdbSNP:16844798
complement(1026)-c, adbSNP:76429341
complement(1118)-g, adbSNP:112750534
complement(1149)-t, adbSNP:187340849
complement(1422)-t, cdbSNP:184509644
complement(1428)-g, cdbSNP:192318359
complement(1505)-c, adbSNP:11544459
complement(1522)-t, gdbSNP:189104400
complement(1608)-g, adbSNP:182444865
complement(1657..1661)-, tttaadbSNP:147701876
complement(1657)-, atttadbSNP:60152522
complement(1730)-g, adbSNP:191107303
complement(1796)-t, adbSNP:6758214
complement(2000)-t, cdbSNP:187680337
complement(2005)-g, adbSNP:7594
Gene SymbolYWHAQ
Gene Synonym14-3-3; 1C5; HS1
Chromosome2
Locus Map2p25.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_006826 Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (YWHAQ), mRNA. Full Length $628.14
ORF Sequence $214.02
Title Oligomeric structure of 14-3-3 protein: what do we know about monomers? .
Author Sluchanko,N.N. and Gusev,N.B.
Journal FEBS Lett. 586 (24), 4249-4256 (2012)
Title The progesterone-responsive gene 14-3-3tau enhances the transcriptional activity of progesterone receptor in uterine cells .
Author Ito,M., Urano,T., Hiroi,H., Momoeda,M., Saito,M., Hosokawa,Y., Tsutsumi,R., Zenri,F., Koizumi,M., Nakae,H., Horie-Inoue,K., Fujii,T., Yano,T., Kozuma,S., Inoue,S. and Taketani,Y.
Journal J. Mol. Endocrinol. 49 (3), 193-202 (2012)
Title Cerebrospinal fluid biomarker supported diagnosis of Creutzfeldt-Jakob disease and rapid dementias: a longitudinal multicentre study over 10 years .
Author Stoeck,K., Sanchez-Juan,P., Gawinecka,J., Green,A., Ladogana,A., Pocchiari,M., Sanchez-Valle,R., Mitrova,E., Sklaviadis,T., Kulczycki,J., Slivarichova,D., Saiz,A., Calero,M., Knight,R., Aguzzi,A., Laplanche,J.L., Peoc'h,K., Schelzke,G., Karch,A., van Duijn,C.M. and Zerr,I.
Journal Brain 135 (PT 10), 3051-3061 (2012)
Title [Degradation of 14-3-3beta appeared in apoptosis cell induced by PrP106-126 polypeptide] .
Author Sun,P., Song,J., Zhang,J., Song,Q.Q., Gan,X., Cui,Y., Gao,C., Bo,X.Z. and Han,J.
Journal Bing Du Xue Bao 28 (4), 414-417 (2012)
Title The weak complex between RhoGAP protein ARHGAP22 and signal regulatory protein 14-3-3 has 1:2 stoichiometry and a single peptide binding mode .
Author Hu,S.H., Whitten,A.E., King,G.J., Jones,A., Rowland,A.F., James,D.E. and Martin,J.L.
Journal PLoS ONE 7 (8), E41731 (2012)
Title Activation-modulated association of 14-3-3 proteins with Cbl in T cells .
Author Liu,Y.C., Elly,C., Yoshida,H., Bonnefoy-Berard,N. and Altman,A.
Journal J. Biol. Chem. 271 (24), 14591-14595 (1996)
Title Inhibition of phosphatidylinositol 3-kinase activity by association with 14-3-3 proteins in T cells .
Author Bonnefoy-Berard,N., Liu,Y.C., von Willebrand,M., Sung,A., Elly,C., Mustelin,T., Yoshida,H., Ishizaka,K. and Altman,A.
Journal Proc. Natl. Acad. Sci. U.S.A. 92 (22), 10142-10146 (1995)
Title Structure of a 14-3-3 protein and implications for coordination of multiple signalling pathways .
Author Xiao,B., Smerdon,S.J., Jones,D.H., Dodson,G.G., Soneji,Y., Aitken,A. and Gamblin,S.J.
Journal Nature 376 (6536), 188-191 (1995)
Title Molecular cloning and expression of the transformation sensitive epithelial marker stratifin. A member of a protein family that has been involved in the protein kinase C signalling pathway .
Author Leffers,H., Madsen,P., Rasmussen,H.H., Honore,B., Andersen,A.H., Walbum,E., Vandekerckhove,J. and Celis,J.E.
Journal J. Mol. Biol. 231 (4), 982-998 (1993)
Title Primary structure of a human protein kinase regulator protein .
Author Nielsen,P.J.
Journal Biochim. Biophys. Acta 1088 (3), 425-428 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878