• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens crystallin, gamma D (CRYGD), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19598 Homo sapiens crystallin, gamma D (CRYGD), mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu19598C Homo sapiens crystallin, gamma D (CRYGD), mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_006891.3, 171906614
Length 525 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens crystallin, gamma D (CRYGD), mRNA.
Product gamma-crystallin D
Comment

Summary: Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. They are differentially regulated after early development. Four gamma-crystallin genes (gamma-A through gamma-D) and three pseudogenes (gamma-E, gamma-F, gamma-G) are tandemly organized in a genomic segment as a gene cluster. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation. [provided by RefSeq, Jul 2008].

RefSeq NP_008822.2
CDS 117..641
Misc Feature(1)123..362
Misc Feature(2)123..362
Misc Feature(3)252..254
Misc Feature(4)366..377
Misc Feature(5)381..626
Misc Feature(6)447..449
Exon (1)126..368
Gene:CRYGD
Gene Synonym:CACA; CCA3; CCP; cry-g-D; CRYG4; CTRCT4; PCC
Exon (2)369..707
Gene:CRYGD
Gene Synonym:CACA; CCA3; CCP; cry-g-D; CRYG4; CTRCT4; PCC
Translation MGKITLYEDRGFQGRHYECSSDHPNLQPYLSRCNSARVDSGCWMLYEQPNYSGLQYFLRR GDYADHQQWMGLSDSVRSCRLIPHSGSHRIRLYEREDYRGQMIEFTEDCSCLQDRFRFNE IHSLNVLEGSWVLYELSNYRGRQYLLMPGDYRRYQDWGATNARVGSLRRVIDFS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(59)-dbSNP:
complement(59)-g, adbSNP:376246921
complement(66..87)-, tggtggggcggcggcgctgagcdbSNP:367690346
complement(76)-t, cdbSNP:367703868
complement(77)-g, adbSNP:113618781
complement(87)-t, gdbSNP:181890669
159+dbSNP:
159+c, tdbSNP:121909595
complement(167)-g, adbSNP:2242074
complement(167)-g, adbSNP:200375285
complement(179)-g, adbSNP:150961505
186+a, c, tdbSNP:28931605
complement(197)-t, cdbSNP:372704290
complement(223)-g, adbSNP:200234608
complement(224)-t, cdbSNP:200388674
225+a, cdbSNP:121909597
complement(236)-t, gdbSNP:374192743
complement(246)-t, cdbSNP:140206746
complement(266)-t, gdbSNP:146108791
complement(284)-g, cdbSNP:202233735
292+a, gdbSNP:121909596
complement(297)-c, adbSNP:150857132
complement(304)-t, cdbSNP:370450479
complement(305)-g, adbSNP:200911604
complement(345)-g, adbSNP:375824046
complement(356)-g, adbSNP:201111017
complement(366)-g, adbSNP:372878552
complement(380)-dbSNP:
complement(380)-g, cdbSNP:75156162
complement(394)-t, cdbSNP:138939316
complement(401)-t, cdbSNP:2305430
complement(459)-g, adbSNP:374584101
complement(472)-t, cdbSNP:370051610
complement(492)-t, cdbSNP:150318966
complement(506)-g, adbSNP:140234939
518+a, cdbSNP:398122948
complement(526)-g, cdbSNP:143171931
complement(535)-t, cdbSNP:144372987
586+a, gdbSNP:121909598
complement(589)-g, cdbSNP:148554364
complement(653)-g, adbSNP:2305429
654+c, tdbSNP:137852882
complement(672)-t, cdbSNP:370488500
complement(674)-t, gdbSNP:377239415
complement(677)-t, gdbSNP:373093118
complement(705)-c, adbSNP:183496209
Gene SymbolCRYGD
Gene SynonymCACA; CCA3; CCP; cry-g-D; CRYG4; CTRCT4; PCC
Chromosome2
Locus Map2q33.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_006891 Homo sapiens crystallin, gamma D (CRYGD), mRNA. On-demand $159.00 7-9
Title Potential of human gammaD-crystallin for hair damage repair: insights into the mechanical properties and biocompatibility .
Author Ribeiro A, Matama T, Cruz CF, Gomes AC and Cavaco-Paulo AM.
Journal Int J Cosmet Sci 35 (5), 458-466 (2013)
Title Amyloid fiber formation in human gammaD-Crystallin induced by UV-B photodamage .
Author Moran SD, Zhang TO, Decatur SM and Zanni MT.
Journal Biochemistry 52 (36), 6169-6181 (2013)
Title Crystal structure of the cataract-causing P23T gammaD-crystallin mutant .
Author Ji F, Koharudin LM, Jung J and Gronenborn AM.
Journal Proteins 81 (9), 1493-1498 (2013)
Title The human W42R gammaD-crystallin mutant structure provides a link between congenital and age-related cataracts .
Author Ji F, Jung J, Koharudin LM and Gronenborn AM.
Journal J. Biol. Chem. 288 (1), 99-109 (2013)
Title Combinational analysis of linkage and exome sequencing identifies the causative mutation in a Chinese family with congenital cataract .
Author Jia X, Zhang F, Bai J, Gao L, Zhang X, Sun H, Sun D, Guan R, Sun W, Xu L, Yue Z, Yu Y and Fu S.
Journal BMC Med. Genet. 14, 107 (2013)
Title Human gamma-crystallin genes. A gene family on its way to extinction .
Author Brakenhoff RH, Aarts HJ, Reek FH, Lubsen NH and Schoenmakers JG.
Journal J. Mol. Biol. 216 (3), 519-532 (1990)
Title Gamma-crystallins of the human eye lens: expression analysis of five members of the gene family .
Author Meakin SO, Du RP, Tsui LC and Breitman ML.
Journal Mol. Cell. Biol. 7 (8), 2671-2679 (1987)
Title A locus for a human hereditary cataract is closely linked to the gamma-crystallin gene family .
Author Lubsen,N.H., Renwick,J.H., Tsui,L.C., Breitman,M.L. and Schoenmakers,J.G.
Journal Proc. Natl. Acad. Sci. U.S.A. 84 (2), 489-492 (1987)
Title Assignment of the human gamma-crystallin gene cluster (CRYG) to the long arm of chromosome 2, region q33-36 .
Author Shiloh,Y., Donlon,T., Bruns,G., Breitman,M.L. and Tsui,L.C.
Journal Hum. Genet. 73 (1), 17-19 (1986)
Title Structural and evolutionary relationships among five members of the human gamma-crystallin gene family .
Author Meakin,S.O., Breitman,M.L. and Tsui,L.C.
Journal Mol. Cell. Biol. 5 (6), 1408-1414 (1985)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.