• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu27038 Homo sapiens polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A), mRNA. pcDNA3.1+-DYK On-demand $1699.00 25
OHu27038C Homo sapiens polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A), mRNA. Customized vector On-demand $1699.00 25

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_007055.3, 296011005
Length 4173 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A), mRNA.
Product DNA-directed RNA polymerase III subunit RPC1
Comment

Summary: The protein encoded by this gene is the catalytic component of RNA polymerase III, which synthesizes small RNAs. The encoded protein also acts as a sensor to detect foreign DNA and trigger an innate immune response. [provided by RefSeq, Aug 2011].

RefSeq NP_008986.2
CDS 134..4306
Misc Feature(1)152..2923
Misc Feature(2)152..2923
Misc Feature(3)203..2806
Misc Feature(4)order(338..340,347..349,368..370,377..379)
Misc Feature(5)order(1175..1177,1190..1192,1211..1213,1229..1231)
Misc Feature(6)1466..1468
Misc Feature(7)order(1628..1630,1634..1636,1640..1642)
Misc Feature(8)2654..4087
Misc Feature(9)2663..2701
Misc Feature(10)3194..4213
Misc Feature(11)order(3200..3205,3215..3217,3224..3226,4202..4204,
Misc Feature(12)order(3215..3400,3413..3457,3740..3775,3800..3961,
Misc Feature(13)order(3227..3229,3236..3238,4118..4120,4148..4156,
Misc Feature(14)order(3362..3364,4046..4048,4097..4102,4109..4111)
Misc Feature(15)order(3842..3844,3860..3865,3869..3871,3899..3919,
Misc Feature(16)4073..4198
Exon (1)1..177
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (2)178..313
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (3)314..451
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (4)452..623
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (5)624..778
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (6)779..1018
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (7)1019..1181
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (8)1182..1318
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (9)1319..1422
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (10)1423..1564
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (11)1565..1705
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (12)1706..1775
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (13)1776..1903
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (14)1904..2042
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (15)2043..2207
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (16)2208..2380
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (17)2381..2492
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (18)2493..2611
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (19)2612..2749
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (20)2750..2920
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (21)2921..3034
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (22)3035..3121
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (23)3122..3204
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (24)3205..3375
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (25)3376..3469
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (26)3470..3562
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (27)3563..3727
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (28)3728..3892
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (29)3893..4024
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (30)4025..4157
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (31)4158..6635
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Translation MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNQHAPLLYGVLDHRM GTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQE EKKQFLDYLKRPGLTYLQKRGLKKKISDKCRKKNICHHCGAFNGTVKKCGLLKIIHEKYK TNKKVVDPIVSNFLQSFETAIEHNKEVEPLLGRAQENLNPLVVLNLFKRIPAEDVPLLLM NPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRISG AKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQGRFRGNLSGKR VDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVQNGPEVHPGANF IQQRHTQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARV KPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIA AIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQI FSVILRPSDDNPVRANLRTKGKQYCGKGEDLCANDSYVTIQNSELMSGSMDKGTLGSGSK NNIFYILLRDWGQNEAADAMSRLARLAPVYLSNRGFSIGIGDVTPGQGLLKAKYELLNAG YKKCDEYIEALNTGKLQQQPGCTAEETLEALILKELSVIRDHAGSACLRELDKSNSPLTM ALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVANSFYS GLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQF IYGGDGLDPAAMEGKDEPLEFKRVLDNIKAVFPCPSEPALSKNELILTTESIMKKSEFLC CQDSFLQEIKKFIKGVSEKIKKTRDKYGINDNGTTEPRVLYQLDRITPTQVEKFLETCRD KYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKAI STPIITAQLDKDDDADYARLVKGRIEKTLLGEISEYIEEVFLPDDCFILVKLSLERIRLL RLEVNAETVRYSICTSKLRVKPGDVAVHGEAVVCVTPRENSKSSMYYVLQFLKEDLPKVV VQGIPEVSRAVIHIDEQSGKEKYKLLVEGDNLRAVMATHGVKGTRTTSNNTYEVEKTLGI EAARTTIINEIQYTMVNHGMSIDRRHVMLLSDLMTYKGEVLGITRFGLAKMKESVLMLAS FEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFD TNEFHIPLVT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(31)-dbSNP:
complement(31)-t, adbSNP:117201371
complement(40)-t, cdbSNP:145832135
complement(80)-c, adbSNP:369900507
complement(99)-g, cdbSNP:201700756
complement(152..153)-, gdbSNP:35384265
complement(253)-dbSNP:
complement(253)-g, adbSNP:200284369
complement(289)-t, cdbSNP:373974792
complement(318)-dbSNP:
complement(318)-g, adbSNP:185508362
complement(319)-t, cdbSNP:140901011
complement(362)-c, adbSNP:137870981
complement(373)-t, gdbSNP:12248310
complement(400)-t, cdbSNP:140284848
complement(408)-g, cdbSNP:200952070
complement(415)-g, adbSNP:201709900
complement(426)-c, adbSNP:76493560
complement(443)-t, cdbSNP:370741493
complement(465)-dbSNP:
complement(465)-g, adbSNP:146683935
complement(492)-t, adbSNP:201730227
complement(529)-g, adbSNP:143082293
complement(530)-t, cdbSNP:149184216
551+c, tdbSNP:267608678
complement(571)-g, adbSNP:16935547
complement(583)-g, adbSNP:370305957
complement(614)-t, cdbSNP:368716943
complement(623)-c, adbSNP:200605001
complement(628)-dbSNP:
complement(628)-g, adbSNP:150057980
complement(629)-t, cdbSNP:370515749
complement(642)-c, adbSNP:370935731
complement(659)-g, cdbSNP:140223464
complement(722)-g, adbSNP:112779671
complement(734)-t, cdbSNP:377131755
complement(754)-t, cdbSNP:149192341
complement(833)-dbSNP:
complement(833)-t, cdbSNP:200561466
complement(834)-t, adbSNP:375183429
complement(841)-c, adbSNP:371777055
complement(856)-g, adbSNP:369355667
complement(865)-g, adbSNP:376011975
complement(874)-t, cdbSNP:12764690
complement(893)-g, adbSNP:141659018
complement(907)-g, adbSNP:144576999
complement(1004)-t, cdbSNP:140717091
complement(1013)-t, cdbSNP:111586184
complement(1060)-dbSNP:
complement(1060)-g, adbSNP:41274610
complement(1090)-g, adbSNP:374888584
complement(1157)-t, cdbSNP:141899032
complement(1186)-dbSNP:
complement(1186)-t, adbSNP:376371251
complement(1238)-t, cdbSNP:373183652
1247+a, gdbSNP:267608673
complement(1255)-g, adbSNP:375483659
complement(1276)-g, adbSNP:372260297
complement(1303)-t, cdbSNP:148659542
complement(1337)-dbSNP:
complement(1337)-t, gdbSNP:376585106
complement(1354)-g, cdbSNP:371529504
complement(1360)-t, cdbSNP:144892779
complement(1444)-dbSNP:
complement(1444)-t, cdbSNP:188441842
complement(1451)-t, adbSNP:372239767
complement(1480)-t, gdbSNP:202142892
complement(1493)-g, cdbSNP:368681602
complement(1499)-t, cdbSNP:199904242
complement(1521)-t, adbSNP:375347113
complement(1534)-c, adbSNP:142659442
complement(1583)-dbSNP:
complement(1583)-g, adbSNP:138165137
complement(1699)-c, adbSNP:12255950
complement(1708)-dbSNP:
complement(1708)-c, adbSNP:138538977
1807+dbSNP:
1807+c, gdbSNP:267608668
complement(1809)-g, adbSNP:369271479
complement(1849)-c, adbSNP:199523517
complement(1852)-c, adbSNP:150105323
complement(1857)-t, adbSNP:56214655
complement(1862)-t, cdbSNP:151084236
complement(1867)-t, adbSNP:376753355
complement(1877)-g, adbSNP:187245012
complement(1878)-t, c, adbSNP:34588967
complement(1887)-g, adbSNP:141758442
complement(1888)-t, cdbSNP:34019581
complement(1897)-g, cdbSNP:372916792
complement(1921)-dbSNP:
complement(1921)-t, cdbSNP:372065442
complement(1924)-t, cdbSNP:374732894
complement(1950)-g, cdbSNP:147944282
complement(1957)-g, adbSNP:376895980
complement(1976)-t, cdbSNP:144946862
complement(1985)-g, adbSNP:140675021
complement(1986)-t, cdbSNP:371170124
complement(2005)-g, adbSNP:373675568
complement(2015)-t, cdbSNP:371073485
complement(2034)-t, cdbSNP:376651203
2040+a, cdbSNP:267608676
complement(2042)-g, adbSNP:201990958
complement(2081)-dbSNP:
complement(2081)-t, cdbSNP:145211567
complement(2132)-c, adbSNP:201390524
complement(2137)-c, adbSNP:372455673
2148+a, gdbSNP:267608670
complement(2182)-g, adbSNP:150003443
complement(2183)-g, c, adbSNP:202145420
complement(2195)-g, adbSNP:372173525
complement(2202)-t, cdbSNP:139329658
complement(2214)-dbSNP:
complement(2214)-t, cdbSNP:376405070
complement(2233)-g, adbSNP:79793998
complement(2234)-t, cdbSNP:142520086
complement(2272)-g, cdbSNP:35354908
complement(2291)-t, cdbSNP:373106090
complement(2298)-t, cdbSNP:369082686
complement(2300)-t, gdbSNP:376927740
2304+a, gdbSNP:267608679
complement(2329)-g, adbSNP:148527796
complement(2332)-t, cdbSNP:373577649
complement(2333)-t, cdbSNP:146265067
complement(2352)-g, cdbSNP:369810361
complement(2381)-dbSNP:
complement(2381)-t, cdbSNP:141868519
complement(2419)-g, adbSNP:16935534
complement(2437)-g, adbSNP:143043294
complement(2438)-g, adbSNP:188164557
2457+a, tdbSNP:267608672
complement(2467)-g, adbSNP:144671070
complement(2477)-g, adbSNP:137961403
complement(2513)-dbSNP:
complement(2513)-g, adbSNP:146957784
complement(2527)-g, adbSNP:35536566
complement(2556)-t, cdbSNP:374831450
complement(2567)-t, cdbSNP:372788440
complement(2605)-g, adbSNP:139259717
complement(2654)-dbSNP:
complement(2654)-t, cdbSNP:192332506
complement(2656)-g, adbSNP:146899211
complement(2672)-g, adbSNP:76181965
2687+a, gdbSNP:267608671
complement(2692)-g, adbSNP:200663916
complement(2705)-g, adbSNP:187721819
complement(2710)-t, gdbSNP:142657005
complement(2713)-g, adbSNP:77055595
complement(2737)-t, cdbSNP:142834115
complement(2750)-dbSNP:
complement(2750)-g, adbSNP:148932047
complement(2774)-t, cdbSNP:57636571
2823+a, tdbSNP:267608681
complement(2833)-g, adbSNP:145738124
complement(2896)-c, adbSNP:372404871
complement(2909)-c, adbSNP:143722794
complement(2932)-dbSNP:
complement(2932)-t, cdbSNP:200452026
complement(2940)-g, cdbSNP:139271396
2963+g, tdbSNP:267608674
complement(3000)-t, cdbSNP:201082620
complement(3058)-dbSNP:
complement(3058)-t, cdbSNP:200925561
complement(3071)-t, cdbSNP:146253630
complement(3100)-t, gdbSNP:190329364
complement(3109)-g, adbSNP:143461869
complement(3126)-dbSNP:
complement(3126)-t, cdbSNP:139665002
complement(3130)-c, adbSNP:12241228
3146+c, tdbSNP:267608682
complement(3147)-t, cdbSNP:200118797
complement(3154)-g, adbSNP:377326701
complement(3169)-t, cdbSNP:192102097
complement(3197)-g, adbSNP:141603555
complement(3251)-dbSNP:
complement(3251)-t, cdbSNP:147987048
complement(3319)-g, adbSNP:375647710
complement(3388)-dbSNP:
complement(3388)-t, gdbSNP:147369365
complement(3397)-t, cdbSNP:142769100
complement(3408)-t, cdbSNP:373504359
complement(3412)-g, adbSNP:77540138
complement(3413)-t, cdbSNP:146861723
complement(3418)-t, cdbSNP:372155738
complement(3464)-t, cdbSNP:139624168
complement(3475)-dbSNP:
complement(3475)-g, adbSNP:183347762
complement(3484)-t, adbSNP:199559258
complement(3520)-g, adbSNP:368705519
complement(3521)-t, cdbSNP:199581222
complement(3525)-t, cdbSNP:138305578
complement(3569)-dbSNP:
complement(3569)-t, cdbSNP:41274600
complement(3582)-t, cdbSNP:371116845
complement(3586)-g, adbSNP:377503194
complement(3609)-t, cdbSNP:150484386
complement(3632)-g, cdbSNP:372587661
complement(3633..3637)-, atgaadbSNP:373476730
complement(3684)-g, cdbSNP:377457288
complement(3695)-t, g, cdbSNP:140432781
complement(3778)-dbSNP:
complement(3778)-g, adbSNP:147591223
complement(3779)-t, cdbSNP:143679064
complement(3784)-g, cdbSNP:191093143
complement(3793)-t, cdbSNP:141312907
complement(3832)-t, cdbSNP:202013193
complement(3834)-g, cdbSNP:373960739
complement(3835)-t, cdbSNP:146725238
complement(3846)-g, adbSNP:200705099
complement(3850)-g, adbSNP:369164731
complement(3867)-t, cdbSNP:143422889
3875..3876+, accdbSNP:267608669
complement(3888)-t, cdbSNP:148664903
complement(3914)-dbSNP:
complement(3914)-t, cdbSNP:371703979
complement(3919)-g, adbSNP:184961157
complement(3931)-t, cdbSNP:367653979
complement(3939)-t, cdbSNP:144111066
complement(3952)-g, adbSNP:375599173
complement(3955)-g, adbSNP:149961298
complement(3968)-t, cdbSNP:371242089
complement(3979)-g, adbSNP:116197727
complement(3991)-g, adbSNP:373306216
complement(4003)-g, adbSNP:199979965
complement(4034)-dbSNP:
complement(4034)-g, adbSNP:116326625
complement(4105)-t, cdbSNP:142749003
complement(4120)-g, adbSNP:16935497
complement(4123)-g, adbSNP:201875398
4124+a, gdbSNP:267608680
complement(4135)-g, adbSNP:112788477
4139+c, tdbSNP:267608675
complement(4165)-dbSNP:
complement(4165)-g, adbSNP:111314386
complement(4169)-t, adbSNP:149956037
complement(4190)-t, cdbSNP:147168447
complement(4191)-g, adbSNP:368407697
complement(4199)-t, cdbSNP:267602588
complement(4204)-g, adbSNP:140044475
complement(4234)-g, adbSNP:148146557
complement(4259)-t, gdbSNP:185669283
complement(4271)-t, cdbSNP:143800893
complement(4282)-t, adbSNP:370868154
complement(4349)-g, adbSNP:368142672
complement(4391)-g, adbSNP:371896851
4396+c, tdbSNP:146055367
complement(4430)-t, adbSNP:375589784
complement(4463..4465)-, gagdbSNP:376961845
complement(4507)-t, c, adbSNP:180866130
complement(4557)-g, cdbSNP:12264652
complement(4578)-g, cdbSNP:2241547
complement(4645)-t, cdbSNP:142880941
complement(4651)-t, gdbSNP:74538796
complement(4732)-g, adbSNP:76696077
complement(4757)-g, cdbSNP:187985904
4776+c, tdbSNP:74704054
complement(4926)-t, cdbSNP:184043149
4979+c, tdbSNP:150842225
complement(4988)-t, cdbSNP:191565691
complement(4996)-g, adbSNP:74451934
complement(5119)-t, cdbSNP:186927032
complement(5124)-t, cdbSNP:185309450
complement(5169)-g, adbSNP:369531611
complement(5189)-t, adbSNP:113075575
complement(5226)-g, adbSNP:77590844
complement(5239)-g, adbSNP:11002352
complement(5294)-g, adbSNP:376110690
5300+a, gdbSNP:148339082
complement(5458)-t, cdbSNP:143418325
complement(5474)-t, cdbSNP:193104439
complement(5609)-g, adbSNP:188968443
complement(5629)-g, adbSNP:45570840
complement(5645)-t, gdbSNP:183880409
complement(5648)-, tdbSNP:56144624
complement(5649)-t, cdbSNP:140070093
complement(5754)-t, cdbSNP:78703311
complement(5765..5766)-, cdbSNP:371612101
complement(5767)-t, cdbSNP:3088264
complement(5801)-g, adbSNP:190828434
complement(5895)-t, cdbSNP:16935486
complement(5986)-g, cdbSNP:80022412
complement(6001)-t, cdbSNP:61152426
complement(6024)-g, cdbSNP:144088118
complement(6040)-c, adbSNP:41274598
complement(6069)-t, cdbSNP:4979935
complement(6088)-t, cdbSNP:11817392
complement(6159)-g, adbSNP:11002351
complement(6160)-t, cdbSNP:186668915
complement(6168)-t, cdbSNP:12572507
complement(6173)-t, gdbSNP:137945349
complement(6230)-t, cdbSNP:146925988
complement(6259)-g, cdbSNP:141086010
complement(6271)-t, cdbSNP:2241546
complement(6336..6337)-, cdbSNP:35772574
complement(6344)-t, cdbSNP:182178080
complement(6345)-g, adbSNP:114774764
complement(6391)-t, cdbSNP:190371858
complement(6439)-g, adbSNP:372763724
complement(6459)-t, adbSNP:145516401
complement(6506)-, adbSNP:34076253
complement(6603)-t, cdbSNP:185660125
Gene SymbolPOLR3A
Gene SynonymADDH; HLD7; hRPC155; RPC1; RPC155
Chromosome10
Locus Map10q22-q23
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_007055 Homo sapiens polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A), mRNA. On-demand $1699.00 25
NM_007055 Homo sapiens polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A), mRNA. On-demand $1699.00 25
Title Mutations in POLR3A and POLR3B are a major cause of hypomyelinating leukodystrophies with or without dental abnormalities and/or hypogonadotropic hypogonadism .
Author Daoud H, Tetreault M, Gibson W, Guerrero K, Cohen A, Gburek-Augustat J, Synofzik M, Brais B, Stevens CA, Sanchez-Carpintero R, Goizet C, Naidu S, Vanderver A and Bernard G.
Journal J. Med. Genet. 50 (3), 194-197 (2013)
Title Mutations in POLR3A and POLR3B encoding RNA Polymerase III subunits cause an autosomal-recessive hypomyelinating leukoencephalopathy .
Author Saitsu H, Osaka H, Sasaki M, Takanashi J, Hamada K, Yamashita A, Shibayama H, Shiina M, Kondo Y, Nishiyama K, Tsurusaki Y, Miyake N, Doi H, Ogata K, Inoue K and Matsumoto N.
Journal Am. J. Hum. Genet. 89 (5), 644-651 (2011)
Title Mutations of POLR3A encoding a catalytic subunit of RNA polymerase Pol III cause a recessive hypomyelinating leukodystrophy .
Author Bernard G, Chouery E, Putorti ML, Tetreault M, Takanohashi A, Carosso G, Clement I, Boespflug-Tanguy O, Rodriguez D, Delague V, Abou Ghoch J, Jalkh N, Dorboz I, Fribourg S, Teichmann M, Megarbane A, Schiffmann R, Vanderver A and Brais B.
Journal Am. J. Hum. Genet. 89 (3), 415-423 (2011)
Title Prevalence, correlates and clinical usefulness of antibodies to RNA polymerase III in systemic sclerosis: a cross-sectional analysis of data from an Australian cohort .
Author Nikpour M, Hissaria P, Byron J, Sahhar J, Micallef M, Paspaliaris W, Roddy J, Nash P, Sturgess A, Proudman S and Stevens W.
Journal Arthritis Res. Ther. 13 (6), R211 (2011)
Title Identification of an immunodominant epitope on RNA polymerase III recognized by systemic sclerosis sera: application to enzyme-linked immunosorbent assay .
Author Kuwana M, Kimura K and Kawakami Y.
Journal Arthritis Rheum. 46 (10), 2742-2747 (2002)
Title Nuclear particles containing RNA polymerase III complexes associated with the junctional plaque protein plakophilin 2 .
Author Mertens C, Hofmann I, Wang Z, Teichmann M, Sepehri Chong S, Schnolzer M and Franke WW.
Journal Proc. Natl. Acad. Sci. U.S.A. 98 (14), 7795-7800 (2001)
Title The largest subunit of human RNA polymerase III is closely related to the largest subunit of yeast and trypanosome RNA polymerase III .
Author Sepehri S and Hernandez N.
Journal Genome Res. 7 (10), 1006-1019 (1997)
Title Leukodystrophy Overview .
Author Vanderver,A., Tonduti,D., Schiffmann,R., Schmidt,J. and Van der Knaap,M.S.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Pol III-Related Leukodystrophies .
Author Bernard,G. and Vanderver,A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title The human immunodeficiency virus tat protein increases the transcription of human Alu repeated sequences by increasing the activity of the cellular transcription factor TFIIIC .
Author Jang KL, Collins MK and Latchman DS.
Journal J. Acquir. Immune Defic. Syndr. 5 (11), 1142-1147 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.