• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_007055 Homo sapiens polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A), mRNA. GenEZ ORF Cloning On-demand $1699.00 25

*Business Day

Related Services

RefSeq Version NM_007055.3, 296011005
Length 6652 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A), mRNA.
Product DNA-directed RNA polymerase III subunit RPC1
Comment

Summary: The protein encoded by this gene is the catalytic component of RNA polymerase III, which synthesizes small RNAs. The encoded protein also acts as a sensor to detect foreign DNA and trigger an innate immune response. [provided by RefSeq, Aug 2011].

RefSeq NP_008986.2
CDS 134..4306
Misc Feature(1)152..2923
Misc Feature(2)152..2923
Misc Feature(3)167..1201
Misc Feature(4)875..1783
Misc Feature(5)1466..1468
Misc Feature(6)1715..2242
Misc Feature(7)2318..2635
Misc Feature(8)2654..4087
Misc Feature(9)2663..2701
Misc Feature(10)3194..4213
Misc Feature(11)order(3200..3205,3215..3217,3224..3226,4202..4204,
Misc Feature(12)order(3215..3400,3413..3457,3740..3775,3800..3961,
Misc Feature(13)order(3227..3229,3236..3238,4118..4120,4148..4156,
Misc Feature(14)order(3362..3364,4046..4048,4097..4102,4109..4111)
Misc Feature(15)order(3842..3844,3860..3865,3869..3871,3899..3919,
Misc Feature(16)4073..4198
Exon (1)1..177
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (2)178..313
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (3)314..451
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (4)452..623
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (5)624..778
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (6)779..1018
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (7)1019..1181
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (8)1182..1318
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (9)1319..1422
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (10)1423..1564
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (11)1565..1705
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (12)1706..1775
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (13)1776..1903
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (14)1904..2042
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (15)2043..2207
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (16)2208..2380
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (17)2381..2492
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (18)2493..2611
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (19)2612..2749
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (20)2750..2920
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (21)2921..3034
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (22)3035..3121
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (23)3122..3204
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (24)3205..3375
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (25)3376..3469
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (26)3470..3562
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (27)3563..3727
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (28)3728..3892
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (29)3893..4024
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (30)4025..4157
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Exon (31)4158..6635
Gene:POLR3A
Gene Synonym:ADDH; HLD7; hRPC155; RPC1; RPC155
Translation MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNQHAPLLYGVLDHRM GTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQE EKKQFLDYLKRPGLTYLQKRGLKKKISDKCRKKNICHHCGAFNGTVKKCGLLKIIHEKYK TNKKVVDPIVSNFLQSFETAIEHNKEVEPLLGRAQENLNPLVVLNLFKRIPAEDVPLLLM NPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRISG AKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQGRFRGNLSGKR VDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVQNGPEVHPGANF IQQRHTQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARV KPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIA AIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQI FSVILRPSDDNPVRANLRTKGKQYCGKGEDLCANDSYVTIQNSELMSGSMDKGTLGSGSK NNIFYILLRDWGQNEAADAMSRLARLAPVYLSNRGFSIGIGDVTPGQGLLKAKYELLNAG YKKCDEYIEALNTGKLQQQPGCTAEETLEALILKELSVIRDHAGSACLRELDKSNSPLTM ALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVANSFYS GLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQF IYGGDGLDPAAMEGKDEPLEFKRVLDNIKAVFPCPSEPALSKNELILTTESIMKKSEFLC CQDSFLQEIKKFIKGVSEKIKKTRDKYGINDNGTTEPRVLYQLDRITPTQVEKFLETCRD KYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKAI STPIITAQLDKDDDADYARLVKGRIEKTLLGEISEYIEEVFLPDDCFILVKLSLERIRLL RLEVNAETVRYSICTSKLRVKPGDVAVHGEAVVCVTPRENSKSSMYYVLQFLKEDLPKVV VQGIPEVSRAVIHIDEQSGKEKYKLLVEGDNLRAVMATHGVKGTRTTSNNTYEVEKTLGI EAARTTIINEIQYTMVNHGMSIDRRHVMLLSDLMTYKGEVLGITRFGLAKMKESVLMLAS FEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFD TNEFHIPLVT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(31)-dbSNP:
complement(31)-t, adbSNP:117201371
complement(40)-t, cdbSNP:145832135
complement(99)-g, cdbSNP:201700756
complement(152..153)-, gdbSNP:35384265
complement(253)-dbSNP:
complement(253)-g, adbSNP:200284369
complement(318)-dbSNP:
complement(318)-g, adbSNP:185508362
complement(319)-t, cdbSNP:140901011
complement(362)-c, adbSNP:137870981
complement(373)-t, gdbSNP:12248310
complement(400)-t, cdbSNP:140284848
complement(408)-g, cdbSNP:200952070
complement(415)-g, adbSNP:201709900
complement(426)-c, adbSNP:76493560
complement(465)-dbSNP:
complement(465)-g, adbSNP:146683935
complement(492)-t, adbSNP:201730227
complement(529)-g, adbSNP:143082293
complement(530)-t, cdbSNP:149184216
complement(551)-t, cdbSNP:267608678
complement(571)-g, adbSNP:16935547
complement(623)-c, adbSNP:200605001
complement(628)-dbSNP:
complement(628)-g, adbSNP:150057980
complement(659)-g, cdbSNP:140223464
complement(722)-g, adbSNP:112779671
complement(754)-t, cdbSNP:149192341
complement(833)-dbSNP:
complement(833)-t, cdbSNP:200561466
complement(874)-t, cdbSNP:12764690
complement(893)-g, adbSNP:141659018
complement(907)-g, adbSNP:144576999
complement(1004)-t, cdbSNP:140717091
complement(1013)-t, cdbSNP:111586184
complement(1060)-dbSNP:
complement(1060)-g, adbSNP:41274610
complement(1157)-t, cdbSNP:141899032
complement(1247)-dbSNP:
complement(1247)-g, adbSNP:267608673
complement(1303)-t, cdbSNP:148659542
complement(1360)-dbSNP:
complement(1360)-t, cdbSNP:144892779
complement(1444)-dbSNP:
complement(1444)-t, cdbSNP:188441842
complement(1480)-t, gdbSNP:202142892
complement(1499)-t, cdbSNP:199904242
complement(1534)-c, adbSNP:142659442
complement(1583)-dbSNP:
complement(1583)-g, adbSNP:138165137
complement(1699)-c, adbSNP:12255950
complement(1708)-dbSNP:
complement(1708)-c, adbSNP:138538977
complement(1807)-dbSNP:
complement(1807)-g, cdbSNP:267608668
complement(1849)-c, adbSNP:199523517
complement(1852)-c, adbSNP:150105323
complement(1857)-t, adbSNP:56214655
complement(1862)-t, cdbSNP:151084236
complement(1877)-g, adbSNP:187245012
complement(1878)-t, c, adbSNP:34588967
complement(1887)-g, adbSNP:141758442
complement(1888)-t, cdbSNP:34019581
complement(1950)-dbSNP:
complement(1950)-g, cdbSNP:147944282
complement(1976)-t, cdbSNP:144946862
complement(1985)-g, adbSNP:140675021
complement(2040)-c, adbSNP:267608676
complement(2042)-g, adbSNP:201990958
complement(2081)-dbSNP:
complement(2081)-t, cdbSNP:145211567
complement(2132)-c, adbSNP:201390524
complement(2148)-g, adbSNP:267608670
complement(2182)-g, adbSNP:150003443
complement(2183)-g, c, adbSNP:202145420
complement(2202)-t, cdbSNP:139329658
complement(2233)-dbSNP:
complement(2233)-g, adbSNP:79793998
complement(2234)-t, cdbSNP:142520086
complement(2272)-g, cdbSNP:35354908
complement(2304)-g, adbSNP:267608679
complement(2329)-g, adbSNP:148527796
complement(2333)-t, cdbSNP:146265067
complement(2381)-dbSNP:
complement(2381)-t, cdbSNP:141868519
complement(2419)-g, adbSNP:16935534
complement(2437)-g, adbSNP:143043294
complement(2438)-g, adbSNP:188164557
complement(2457)-t, adbSNP:267608672
complement(2467)-g, adbSNP:144671070
complement(2477)-g, adbSNP:137961403
complement(2513)-dbSNP:
complement(2513)-g, adbSNP:146957784
complement(2527)-g, adbSNP:35536566
complement(2605)-g, adbSNP:139259717
complement(2654)-dbSNP:
complement(2654)-t, cdbSNP:192332506
complement(2656)-g, adbSNP:146899211
complement(2672)-g, adbSNP:76181965
complement(2687)-g, adbSNP:267608671
complement(2692)-g, adbSNP:200663916
complement(2705)-g, adbSNP:187721819
complement(2710)-t, gdbSNP:142657005
complement(2713)-g, adbSNP:77055595
complement(2737)-t, cdbSNP:142834115
complement(2750)-dbSNP:
complement(2750)-g, adbSNP:148932047
complement(2774)-t, cdbSNP:57636571
complement(2823)-t, adbSNP:267608681
complement(2833)-g, adbSNP:145738124
complement(2909)-c, adbSNP:143722794
complement(2932)-dbSNP:
complement(2932)-t, cdbSNP:200452026
complement(2940)-g, cdbSNP:139271396
complement(2963)-t, gdbSNP:267608674
complement(3000)-t, cdbSNP:201082620
complement(3058)-dbSNP:
complement(3058)-t, cdbSNP:200925561
complement(3071)-t, cdbSNP:146253630
complement(3100)-t, gdbSNP:190329364
complement(3109)-g, adbSNP:143461869
complement(3126)-dbSNP:
complement(3126)-t, cdbSNP:139665002
complement(3130)-c, adbSNP:12241228
complement(3146)-t, cdbSNP:267608682
complement(3147)-t, cdbSNP:200118797
complement(3169)-t, cdbSNP:192102097
complement(3197)-g, adbSNP:141603555
complement(3251)-dbSNP:
complement(3251)-t, cdbSNP:147987048
complement(3388)-dbSNP:
complement(3388)-t, gdbSNP:147369365
complement(3397)-t, cdbSNP:142769100
complement(3412)-g, adbSNP:77540138
complement(3413)-t, cdbSNP:146861723
complement(3464)-t, cdbSNP:139624168
complement(3475)-dbSNP:
complement(3475)-g, adbSNP:183347762
complement(3484)-t, adbSNP:199559258
complement(3507)-t, cdbSNP:149215455
complement(3521)-t, cdbSNP:199581222
complement(3525)-t, cdbSNP:138305578
complement(3569)-dbSNP:
complement(3569)-t, cdbSNP:41274600
complement(3609)-t, cdbSNP:150484386
complement(3695)-t, g, cdbSNP:140432781
complement(3778)-dbSNP:
complement(3778)-g, adbSNP:147591223
complement(3779)-t, cdbSNP:143679064
complement(3784)-g, cdbSNP:191093143
complement(3793)-t, cdbSNP:141312907
complement(3832)-t, cdbSNP:202013193
complement(3835)-t, cdbSNP:146725238
complement(3846)-g, adbSNP:200705099
complement(3867)-t, cdbSNP:143422889
complement(3875..3876)-, accdbSNP:267608669
complement(3888)-t, cdbSNP:148664903
complement(3919)-dbSNP:
complement(3919)-g, adbSNP:184961157
complement(3939)-t, cdbSNP:144111066
complement(3955)-g, adbSNP:149961298
complement(3979)-g, adbSNP:116197727
complement(4003)-g, adbSNP:199979965
complement(4034)-dbSNP:
complement(4034)-g, adbSNP:116326625
complement(4105)-t, cdbSNP:142749003
complement(4120)-g, adbSNP:16935497
complement(4123)-g, adbSNP:201875398
complement(4124)-g, adbSNP:267608680
complement(4135)-g, adbSNP:112788477
complement(4139)-t, cdbSNP:267608675
complement(4165)-dbSNP:
complement(4165)-g, adbSNP:111314386
complement(4169)-t, adbSNP:149956037
complement(4190)-t, cdbSNP:147168447
complement(4204)-g, adbSNP:140044475
complement(4234)-g, adbSNP:148146557
complement(4259)-t, gdbSNP:185669283
complement(4271)-t, cdbSNP:143800893
complement(4396)-t, cdbSNP:146055367
complement(4507)-t, cdbSNP:180866130
complement(4557)-g, cdbSNP:12264652
complement(4578)-g, cdbSNP:2241547
complement(4645)-t, cdbSNP:142880941
complement(4651)-t, gdbSNP:74538796
complement(4732)-g, adbSNP:76696077
complement(4757)-g, cdbSNP:187985904
complement(4776)-t, cdbSNP:74704054
complement(4926)-t, cdbSNP:184043149
complement(4979)-t, cdbSNP:150842225
complement(4988)-t, cdbSNP:191565691
complement(4996)-g, adbSNP:74451934
complement(5119)-t, cdbSNP:186927032
complement(5124)-t, cdbSNP:185309450
complement(5189)-t, adbSNP:113075575
complement(5226)-g, adbSNP:77590844
complement(5239)-g, adbSNP:11002352
complement(5300)-g, adbSNP:148339082
complement(5458)-t, cdbSNP:143418325
complement(5474)-t, cdbSNP:193104439
complement(5609)-g, adbSNP:188968443
complement(5629)-g, adbSNP:45570840
complement(5645)-t, gdbSNP:183880409
complement(5648)-, t, ttdbSNP:56144624
complement(5649)-t, cdbSNP:140070093
complement(5754)-t, cdbSNP:78703311
complement(5767)-t, cdbSNP:3088264
complement(5801)-g, adbSNP:190828434
complement(5895)-t, cdbSNP:16935486
complement(5986)-g, cdbSNP:80022412
complement(6001)-t, cdbSNP:61152426
complement(6024)-g, cdbSNP:144088118
complement(6040)-c, adbSNP:41274598
complement(6069)-t, cdbSNP:4979935
complement(6088)-t, cdbSNP:11817392
complement(6159)-g, adbSNP:11002351
complement(6160)-t, cdbSNP:186668915
complement(6168)-t, cdbSNP:12572507
complement(6173)-t, gdbSNP:137945349
complement(6230)-t, cdbSNP:146925988
complement(6259)-g, cdbSNP:141086010
complement(6271)-t, cdbSNP:2241546
complement(6336..6337)-, cdbSNP:35772574
complement(6344)-t, cdbSNP:182178080
complement(6345)-g, adbSNP:114774764
complement(6391)-t, cdbSNP:190371858
complement(6459)-t, adbSNP:145516401
complement(6506)-, adbSNP:34076253
complement(6603)-t, cdbSNP:185660125
Gene SymbolPOLR3A
Gene SynonymADDH; HLD7; hRPC155; RPC1; RPC155
Chromosome10
Locus Map10q22-q23
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_007055 Homo sapiens polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A), mRNA. On-demand $1699.00 25
Title Mutations in POLR3A and POLR3B encoding RNA Polymerase III subunits cause an autosomal-recessive hypomyelinating leukoencephalopathy .
Author Saitsu,H., Osaka,H., Sasaki,M., Takanashi,J., Hamada,K., Yamashita,A., Shibayama,H., Shiina,M., Kondo,Y., Nishiyama,K., Tsurusaki,Y., Miyake,N., Doi,H., Ogata,K., Inoue,K. and Matsumoto,N.
Journal Am. J. Hum. Genet. 89 (5), 644-651 (2011)
Title Mutations of POLR3A encoding a catalytic subunit of RNA polymerase Pol III cause a recessive hypomyelinating leukodystrophy .
Author Bernard,G., Chouery,E., Putorti,M.L., Tetreault,M., Takanohashi,A., Carosso,G., Clement,I., Boespflug-Tanguy,O., Rodriguez,D., Delague,V., Abou Ghoch,J., Jalkh,N., Dorboz,I., Fribourg,S., Teichmann,M., Megarbane,A., Schiffmann,R., Vanderver,A. and Brais,B.
Journal Am. J. Hum. Genet. 89 (3), 415-423 (2011)
Title Prevalence, correlates and clinical usefulness of antibodies to RNA polymerase III in systemic sclerosis: a cross-sectional analysis of data from an Australian cohort .
Author Nikpour,M., Hissaria,P., Byron,J., Sahhar,J., Micallef,M., Paspaliaris,W., Roddy,J., Nash,P., Sturgess,A., Proudman,S. and Stevens,W.
Journal Arthritis Res. Ther. 13 (6), R211 (2011)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip .
Author Talmud,P.J., Drenos,F., Shah,S., Shah,T., Palmen,J., Verzilli,C., Gaunt,T.R., Pallas,J., Lovering,R., Li,K., Casas,J.P., Sofat,R., Kumari,M., Rodriguez,S., Johnson,T., Newhouse,S.J., Dominiczak,A., Samani,N.J., Caulfield,M., Sever,P., Stanton,A., Shields,D.C., Padmanabhan,S., Melander,O., Hastie,C., Delles,C., Ebrahim,S., Marmot,M.G., Smith,G.D., Lawlor,D.A., Munroe,P.B., Day,I.N., Kivimaki,M., Whittaker,J., Humphries,S.E. and Hingorani,A.D.
Journal Am. J. Hum. Genet. 85 (5), 628-642 (2009)
Title Characterization of human RNA polymerase III identifies orthologues for Saccharomyces cerevisiae RNA polymerase III subunits .
Author Hu,P., Wu,S., Sun,Y., Yuan,C.C., Kobayashi,R., Myers,M.P. and Hernandez,N.
Journal Mol. Cell. Biol. 22 (22), 8044-8055 (2002)
Title Identification of an immunodominant epitope on RNA polymerase III recognized by systemic sclerosis sera: application to enzyme-linked immunosorbent assay .
Author Kuwana,M., Kimura,K. and Kawakami,Y.
Journal Arthritis Rheum. 46 (10), 2742-2747 (2002)
Title Nuclear particles containing RNA polymerase III complexes associated with the junctional plaque protein plakophilin 2 .
Author Mertens,C., Hofmann,I., Wang,Z., Teichmann,M., Sepehri Chong,S., Schnolzer,M. and Franke,W.W.
Journal Proc. Natl. Acad. Sci. U.S.A. 98 (14), 7795-7800 (2001)
Title The largest subunit of human RNA polymerase III is closely related to the largest subunit of yeast and trypanosome RNA polymerase III .
Author Sepehri,S. and Hernandez,N.
Journal Genome Res. 7 (10), 1006-1019 (1997)
Title The human immunodeficiency virus tat protein increases the transcription of human Alu repeated sequences by increasing the activity of the cellular transcription factor TFIIIC .
Author Jang,K.L., Collins,M.K. and Latchman,D.S.
Journal J. Acquir. Immune Defic. Syndr. 5 (11), 1142-1147 (1992)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.