• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens trio Rho guanine nucleotide exchange factor (TRIO), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_007118 Homo sapiens trio Rho guanine nucleotide exchange factor (TRIO), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_007118.2, 45439358
Length 10244 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens trio Rho guanine nucleotide exchange factor (TRIO), mRNA.
Product triple functional domain protein
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BF058117.1, BC035585.1, U42390.1, AI478154.1, BQ691537.1, AF091395.1, BC017268.2 and BQ009698.1. On or before Jun 11, 2008 this sequence version replaced gi:169168483, gi:169167724, gi:169167541, gi:6005921.

RefSeq NP_009049.2
CDS 7..9300
Misc Feature(1)205..618
Misc Feature(2)205..618
Misc Feature(3)order(262..264,268..270,274..276,343..345,388..390,
Misc Feature(4)order(457..459,550..552)
Misc Feature(5)694..1341
Misc Feature(6)937..1260
Misc Feature(7)1021..1038
Misc Feature(8)1027..1704
Misc Feature(9)1345..1362
Misc Feature(10)1618..1938
Misc Feature(11)1705..2355
Misc Feature(12)order(2023..2028,2029..2031)
Misc Feature(13)2365..3048
Misc Feature(14)2638..2958
Misc Feature(15)2722..2739
Misc Feature(16)2728..3417
Misc Feature(17)3043..3060
Misc Feature(18)3331..3654
Misc Feature(19)3421..>3744
Misc Feature(20)3889..4401
Misc Feature(21)order(3901..3903,3913..3915,4198..4200,4261..4266,
Misc Feature(22)4420..4788
Misc Feature(23)order(4471..4473,4591..4593,4597..4599)
Misc Feature(24)4981..5160
Misc Feature(25)order(4999..5001,5005..5007,5014..5016,5026..5028,
Misc Feature(26)5713..5715
Misc Feature(27)5914..6435
Misc Feature(28)order(5932..5934,5944..5946,6223..6225,6286..6291,
Misc Feature(29)6448..6864
Misc Feature(30)order(6475..6477,6580..6585,6661..6663,6667..6669,
Misc Feature(31)6850..6852
Misc Feature(32)7369..7371
Misc Feature(33)7381..7383
Misc Feature(34)7669..7845
Misc Feature(35)order(7684..7686,7690..7692,7699..7701,7711..7713,
Misc Feature(36)8059..8334
Misc Feature(37)8101..8334
Misc Feature(38)8392..9156
Misc Feature(39)8392..8394
Misc Feature(40)8410..9138
Misc Feature(41)order(8410..8424,8434..8436,8473..8475,8479..8481,
Misc Feature(42)order(8410..8424,8434..8436,8473..8475,8479..8481,
Misc Feature(43)order(8422..8424,8632..8634,8638..8640,8749..8751,
Misc Feature(44)order(8809..8829,8866..8877)
Exon (1)1..163
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (2)164..238
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (3)239..353
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (4)354..546
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (5)547..1059
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (6)1060..1182
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (7)1183..1374
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (8)1375..1506
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (9)1507..1737
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (10)1738..1860
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (11)1861..2052
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (12)2053..2222
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (13)2223..2397
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (14)2398..2593
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (15)2594..2760
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (16)2761..2880
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (17)2881..3072
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (18)3073..3222
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (19)3223..3337
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (20)3338..3453
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (21)3454..3576
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (22)3577..3771
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (23)3772..3887
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (24)3888..3954
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (25)3955..4064
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (26)4065..4134
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (27)4135..4224
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (28)4225..4317
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (29)4318..4429
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (30)4430..4620
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (31)4621..4722
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (32)4723..4865
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (33)4866..4965
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (34)4966..5209
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (35)5210..5502
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (36)5503..5673
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (37)5674..5769
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (38)5770..5918
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (39)5919..5985
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (40)5986..6089
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (41)6090..6159
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (42)6160..6249
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (43)6250..6342
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (44)6343..6393
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (45)6394..6471
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (46)6472..6663
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (47)6664..6841
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (48)6842..7638
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (49)7639..7886
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (50)7887..8025
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (51)8026..8053
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (52)8054..8216
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (53)8217..8338
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (54)8339..8417
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (55)8418..8618
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (56)8619..8757
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Exon (57)8758..10227
Gene:TRIO
Gene Synonym:ARHGEF23; tgat
Translation MSGSSGGAAAPAASSGPAAAASAAGSGCGGGAGEGAEEAAKDLADIAAFFRSGFRKNDEM KAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRIRQEDLRRLISYLACIPSEEVC KRGFTVIVDMRGSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQRTNFGSSKFEFE TNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVAFEDYISNATHMLSRLEELQDI LAKKELPQDLEGARNMIEEHSQLKKKVIKAPIEDLDLEGQKLLQRIQSSESFPKKNSGSG NADLQNLLPKVSTMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWITHNK GLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINRIMSVANRLVESGHYASQQIR QIASQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMSNVDSWCKACGEVDLPSELQDL EDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLDV IHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSL HRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFV RRVEQRKILLDMSVSFHTHVKELWTWLEELQKELLDDVYAESVEAVQDLIKRFGQQQQTT LQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQMEELFQERKI KLELFLQLRIFERDAIDIISDLESWNDELSQQMNDFDTEDLTIAEQRLQHHADKALTMNN LTFDVIHQGQDLLQYVNEVQASGVELLCDRDVDMATRVQDLLEFLHEKQQELDLAAEQHR KHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKT HQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTS EQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRN ADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQY VVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTKERVKLLI QLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGISSDSNKSSKSLQ LDIIPASIPGSEVKLRDAAHELNEEKRKSARRKEFIMAELIQTEKAYVRDLRECMDTYLW EMTSGVEEIPPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQLPEDVGHCFVTWADKF QMYVTYCKNKPDSTQLILEHAGSYFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELL TCCEEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGFDENIESQGELILQESFQVWDPKTL IRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEGDPCKFALWVG RTPTSDNKIVLKASSIENKQDWIKHIREVIQERTIHLKGALKEPIHIPKTAPATRQKGRR DGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFTACNSNELTIRRG QTVEVLERPHDKPDWCLVRTTDRSPAAEGLVPCGSLCIAHSRSSMEMEGIFNHKDSLSVS SNDASPPASVASLQPHMIGAQSSPGPKRPGNTLRKWLTSPVRRLSSGKADGHVKKLAHKH KKSREVRKSADAGSQKDSDDSAATPQDETVEERGRNEGLSSGTLSKSSSSGMQSCGEEEG EEGADAVPLPPPMAIQQHSLLQPDSQDDKASSRLLVRPTSSETPSAAELVSAIEELVKSK MALEDRPSSLLVDQGDSSSPSFNPSDNSLLSSSSPIDEMEERKSSSLKRRHYVLQELVET ERDYVRDLGYVVEGYMALMKEDGVPDDMKGKDKIVFGNIHQIYDWHRDFFLGELEKCLED PEKLGSLFVKHERRLHMYIAYCQNKPKSEHIVSEYIDTFFEDLKQRLGHRLQLTDLLIKP VQRIMKYQLLLKDFLKYSKKASLDTSELERAVEVMCIVPRRCNDMMNVGRLQGFDGKIVA QGKLLLQDTFLVTDQDAGLLPRCRERRIFLFEQIVIFSEPLDKKKGFSMPGFLFKNSIKV SCLCLEENVENDPCKFALTSRTGDVVETFILHSSSPSVRQTWIHEINQILENQRNFLNAL TSPIEYQRNHSGGGGGGGSGGSGGGGGSGGGGAPSGGSGHSGGPSSCGGAPSTSRSRPSR IPQPVRHHPPVLVSSAASSQAEADKMSGTSTPGPSLPPPGAAPEAGPSAPSRRPPGADAE GSEREAEPIPKMKVLESPRKGAANASGSSPDAPAKDARASLGTLPLGKPRAGAASPLNSP LSSAVPSLGKEPFPPSSPLQKGGSFWSSIPASPASRPGSFTFPGDSDSLQRQTPRHAAPG KDTDRMSTCSSASEQSVQSTQSNGSESSSSSNISTMLVTHDYTAVKEDEINVYQGEVVQI LASNQQNMFLVFRAATDQCPAAEGWIPGFVLGHTSAVIVENPDGTLKKSTSWHTALRLRK KSEKKDKDGKREGKLENGYRKSREGLSNKVSVKLLNPNYIYDVPPEFVIPLSEVTCETGE TVVLRCRVCGRPKASITWKGPEHNTLNNDGHYSISYSDLGEATLKIVGVTTEDDGIYTCI AVNDMGSASSSASLRVLGPGMDGIMVTWKDNFDSFYSEVAELGRGRFSVVKKCDQKGTKR AVATKFVNKKLMKRDQVTHELGILQSLQHPLLVGLLDTFETPTSYILVLEMADQGRLLDC VVRWGSLTEGKIRAHLGEVLEAVRYLHNCRIAHLDLKPENILVDESLAKPTIKLADFGDA VQLNTTYYIHQLLGNPEFAAPEIILGNPVSLTSDTWSVGVLTYVLLSGVSPFLDDSVEET CLNICRLDFSFPDDYFKGVSQKAKEFVCFLLQEDPAKRPSAALALQEQWLQAGNGRSTGV LDTSRLTSFIERRKHQNDVRPIRSIKNFLQSRLLPRV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
177+dbSNP:
177+c, tdbSNP:55664610
200+g, tdbSNP:201815516
205+c, tdbSNP:146453151
208+a, gdbSNP:146644309
222+a, gdbSNP:140078262
264..265+dbSNP:
264..265+, cdbSNP:34016405
284+a, gdbSNP:376866089
293+a, gdbSNP:368206547
305+a, gdbSNP:372468155
330+c, tdbSNP:149869545
354+dbSNP:
354+c, tdbSNP:144904902
361+g, tdbSNP:149046966
381+a, gdbSNP:145882464
387+c, tdbSNP:370673675
405+c, tdbSNP:200590042
553+dbSNP:
553+a, gdbSNP:138818919
564+a, gdbSNP:141383076
588+c, tdbSNP:147004011
673+c, tdbSNP:367568938
676+a, gdbSNP:370355156
710+a, gdbSNP:76253382
756+a, gdbSNP:375147033
774+g, tdbSNP:372338229
866+a, gdbSNP:61736757
874+c, gdbSNP:13176883
878+c, gdbSNP:55772118
879+c, tdbSNP:376595846
903+a, gdbSNP:148069224
955+c, tdbSNP:368654118
965+c, tdbSNP:201886294
966+a, gdbSNP:372630442
981+a, gdbSNP:61737132
1050+g, tdbSNP:16903367
1149+dbSNP:
1149+c, gdbSNP:369621289
1164+c, tdbSNP:202060067
1185+dbSNP:
1185+c, tdbSNP:56035446
1205+a, gdbSNP:377745794
1215+a, gdbSNP:189300218
1223+a, gdbSNP:138722140
1254+a, gdbSNP:370222007
1275+a, gdbSNP:377545795
1302+a, gdbSNP:141998293
1412+dbSNP:
1412+a, gdbSNP:146347032
1426+c, tdbSNP:139674608
1501..1502+, adbSNP:34705730
1507+dbSNP:
1507+g, tdbSNP:144438502
1526+c, tdbSNP:201650861
1527+a, gdbSNP:55920001
1565+a, gdbSNP:202028964
1566+c, tdbSNP:200158263
1569+c, tdbSNP:375450837
complement(1573)-t, cdbSNP:75604913
1605+c, tdbSNP:368755419
1623+c, tdbSNP:374834713
1644+c, tdbSNP:56310681
1674+a, gdbSNP:142459776
1708+c, tdbSNP:199637980
1728+c, tdbSNP:371966763
complement(1791)-dbSNP:
complement(1791)-g, adbSNP:2277045
1830+a, gdbSNP:199534371
1866+dbSNP:
1866+a, gdbSNP:201729604
1869+c, tdbSNP:140745100
1914+c, gdbSNP:200911185
2025+a, tdbSNP:199909638
2140+dbSNP:
2140+c, tdbSNP:199843575
2141+a, gdbSNP:370241914
2206+c, tdbSNP:374608016
2211+c, tdbSNP:144301629
2227+dbSNP:
2227+c, tdbSNP:200680465
2236+g, tdbSNP:372417753
2282+c, tdbSNP:201514384
2301+c, tdbSNP:377159049
2313+a, gdbSNP:200525310
2340+c, tdbSNP:202099280
2363+a, tdbSNP:369594884
2379+c, tdbSNP:147805232
2388+c, tdbSNP:374328060
2412+dbSNP:
2412+c, tdbSNP:141315662
2438+a, gdbSNP:201842997
2446+a, gdbSNP:200493238
2455+a, c, gdbSNP:146974332
2486+a, gdbSNP:370634993
2538+c, tdbSNP:55642404
2539+a, gdbSNP:149099057
2576+a, gdbSNP:199976501
2589+c, tdbSNP:191608099
2596+dbSNP:
2596+a, gdbSNP:370010304
2636+c, gdbSNP:201818413
2637+g, tdbSNP:373058808
2646+c, tdbSNP:374767686
2664+c, tdbSNP:371363639
2724+c, tdbSNP:143188595
2754+g, tdbSNP:148295889
2769+dbSNP:
2769+c, tdbSNP:200315399
2781+c, tdbSNP:370683728
2802+a, cdbSNP:141984882
2813+c, tdbSNP:146329050
2817+c, gdbSNP:143042118
2820+c, tdbSNP:142876810
2823+c, gdbSNP:201359759
2886+dbSNP:
2886+a, tdbSNP:202077483
2895+c, tdbSNP:10064745
2896+a, gdbSNP:139892017
2934+a, gdbSNP:148506244
2946+c, tdbSNP:142713400
2950+a, gdbSNP:140274783
2970+c, tdbSNP:144236504
2973+c, gdbSNP:371239588
3003+c, tdbSNP:61748185
3024+c, tdbSNP:367798910
3033+c, tdbSNP:375541439
3039+c, tdbSNP:13189406
3110+dbSNP:
3110+a, gdbSNP:372172691
3114+a, gdbSNP:139527871
3155+a, tdbSNP:200954380
3207+a, gdbSNP:376764382
3252+dbSNP:
3252+c, tdbSNP:61737134
3282+c, tdbSNP:145133665
3362+dbSNP:
3362+a, gdbSNP:373335645
3395+a, gdbSNP:370765048
3426+c, tdbSNP:200856978
3476+dbSNP:
3476+a, gdbSNP:150972552
3480+c, tdbSNP:199861793
3535..3536+, gdbSNP:34701068
3541+c, tdbSNP:368264596
complement(3643)-dbSNP:
complement(3643)-c, adbSNP:76375698
3645+c, tdbSNP:140850570
3647+c, tdbSNP:373893038
3671+c, tdbSNP:150161940
3707+a, g, tdbSNP:145664044
3755+c, tdbSNP:377220745
3770+c, tdbSNP:201215276
3798+dbSNP:
3798+c, tdbSNP:201027927
3800..3801+, cdbSNP:34815762
3812+c, tdbSNP:151049431
3848+a, gdbSNP:373162656
3927+dbSNP:
3927+c, tdbSNP:368226960
3936+c, tdbSNP:367865728
3940+c, tdbSNP:372065440
3956+dbSNP:
3956+a, c, tdbSNP:56051871
3981+c, gdbSNP:145624600
4002..4003+, cdbSNP:35538544
4002+c, tdbSNP:141623489
4026+c, tdbSNP:7715916
4029+c, tdbSNP:142826537
4050+c, tdbSNP:143311108
4113+dbSNP:
4113+g, tdbSNP:377482819
complement(4133)-t, gdbSNP:79341256
4152+dbSNP:
4152+a, gdbSNP:372498676
4224+c, tdbSNP:114288472
4249+dbSNP:
4249+a, gdbSNP:141536428
4299+a, gdbSNP:3205414
4389+dbSNP:
4389+a, gdbSNP:201002918
4394+a, gdbSNP:373502206
complement(4404)-g, adbSNP:30774
4488+dbSNP:
4488+a, gdbSNP:112873657
4599+c, tdbSNP:368915615
4683+dbSNP:
4683+a, gdbSNP:375879436
4702+c, gdbSNP:1802485
4728+dbSNP:
4728+c, tdbSNP:375014472
4732+a, gdbSNP:200972870
4788+a, gdbSNP:182481374
4791+c, tdbSNP:372920972
4813+c, gdbSNP:368358934
4834+a, cdbSNP:77243955
4836+c, gdbSNP:140153002
4838+c, tdbSNP:371141413
4842+c, tdbSNP:374502864
4843+a, gdbSNP:16903474
4850..4851+, tdbSNP:35445238
4917+dbSNP:
4917+a, gdbSNP:149057194
4918+a, gdbSNP:373049743
4926+c, tdbSNP:147339578
4937+c, tdbSNP:55687522
4950+a, g, tdbSNP:112809301
5010+dbSNP:
5010+c, tdbSNP:149477759
5016+c, tdbSNP:1802484
5019+c, tdbSNP:202028325
5037+c, tdbSNP:374579202
5052+c, tdbSNP:368532698
5053+a, gdbSNP:149901641
5075+a, gdbSNP:56292586
5091+c, gdbSNP:374111666
5106+a, cdbSNP:30612
5113+c, tdbSNP:143962916
5114+a, gdbSNP:372237041
5124+a, gdbSNP:142149078
5139+c, tdbSNP:375211381
5175+c, tdbSNP:112897693
5203+c, tdbSNP:368342075
5250+dbSNP:
5250+a, gdbSNP:55812347
5253+c, tdbSNP:371170524
5257+g, tdbSNP:374250319
5337+c, tdbSNP:200595562
5365+g, tdbSNP:372071741
5426+a, gdbSNP:200080176
5431+a, gdbSNP:375051424
5434+a, gdbSNP:368043617
5457+c, gdbSNP:2278692
5463+c, tdbSNP:371802646
5487+c, tdbSNP:375196064
5529+dbSNP:
5529+c, tdbSNP:17500731
5586+c, tdbSNP:146544278
5597+c, tdbSNP:141266137
5598+c, tdbSNP:150213367
5602+a, gdbSNP:373008762
5616+a, gdbSNP:138509776
5649+c, tdbSNP:376976314
5674+dbSNP:
5674+a, gdbSNP:147906245
5677+c, tdbSNP:138840811
5718+a, gdbSNP:374550843
5730+a, gdbSNP:377061540
5733+c, tdbSNP:200594729
5754+c, tdbSNP:370130105
5783+dbSNP:
5783+a, gdbSNP:375877998
5833+a, gdbSNP:201630329
5841+a, gdbSNP:368260455
5871+c, tdbSNP:372898328
5922+dbSNP:
5922+c, tdbSNP:376206672
5982+g, tdbSNP:372829800
5995+dbSNP:
5995+a, gdbSNP:114451941
6054+c, tdbSNP:375203644
6090+dbSNP:
6090+c, gdbSNP:371806945
6113+a, gdbSNP:143747764
6123+a, cdbSNP:374834393
6186+dbSNP:
6186+c, tdbSNP:61756359
6206+a, tdbSNP:138476223
6219+c, tdbSNP:55841211
6222+c, gdbSNP:373040995
6280+dbSNP:
6280+a, cdbSNP:144053719
6371+dbSNP:
6371+a, gdbSNP:188033742
6402+dbSNP:
6402+a, gdbSNP:55693216
6428+a, gdbSNP:147335955
6455+a, gdbSNP:182423419
6471+c, tdbSNP:187902032
6534+dbSNP:
6534+c, tdbSNP:377179966
6544+c, gdbSNP:370640168
6550+c, tdbSNP:373321656
6588+c, tdbSNP:139448086
6589+a, gdbSNP:201465691
6617+a, c, gdbSNP:141648983
6625+g, tdbSNP:373870873
6636+a, gdbSNP:367680636
6660+a, cdbSNP:201985481
6666+dbSNP:
6666+c, gdbSNP:377255423
6690+c, tdbSNP:202233251
6699+c, tdbSNP:369758824
6703+a, c, tdbSNP:61748186
6722+c, tdbSNP:375075483
6731+c, tdbSNP:55916212
6732+a, gdbSNP:150514528
6743+c, tdbSNP:200931566
6789+c, tdbSNP:369103375
6826+c, tdbSNP:372939293
6827+a, gdbSNP:377126633
6843+dbSNP:
6843+c, tdbSNP:139501749
complement(6886)-t, cdbSNP:468203
6894+c, tdbSNP:200735300
complement(6936)-g, cdbSNP:456166
6971+, gdbSNP:34540807
7007+c, gdbSNP:375274497
7057+a, gdbSNP:199638306
7121+c, tdbSNP:199631028
7127+c, tdbSNP:377055423
7151..7152+, adbSNP:34044102
complement(7373)-g, adbSNP:75338052
7397+c, tdbSNP:115054458
7403+c, tdbSNP:373471708
7407+c, tdbSNP:377647192
7446+g, tdbSNP:200727118
7463..7474+, ggagctccatccdbSNP:140308852
7490+c, gdbSNP:370830333
7493+g, tdbSNP:375694147
7497+c, tdbSNP:368444632
7539+a, gdbSNP:371334482
7599+a, gdbSNP:267600468
7614+a, cdbSNP:373630440
7640+dbSNP:
7640+c, gdbSNP:149694127
7659+c, tdbSNP:200075312
7737+c, tdbSNP:146231483
7738+a, gdbSNP:372401976
7758+c, tdbSNP:139348547
7764+c, gdbSNP:375858476
7770+a, gdbSNP:368253813
7784+a, gdbSNP:201937199
7789+a, gdbSNP:369051747
7806+c, tdbSNP:147014315
7861+a, gdbSNP:371688546
7870+a, cdbSNP:146525516
7877+a, gdbSNP:149134122
7880+c, tdbSNP:375286965
7903+dbSNP:
7903+a, cdbSNP:141187569
7916+a, gdbSNP:373487081
7922+c, gdbSNP:377442700
7928+a, cdbSNP:200539540
7951+a, gdbSNP:200240991
8005+a, gdbSNP:151253542
8016+a, gdbSNP:140473514
8033+dbSNP:
8033+a, gdbSNP:150431198
8052+c, tdbSNP:138468997
8067+dbSNP:
8067+c, tdbSNP:371720824
8068+a, gdbSNP:374896197
8072+c, tdbSNP:142582947
8110+a, gdbSNP:200412299
8137+c, tdbSNP:373515068
8138+a, gdbSNP:375871711
8181+c, tdbSNP:370228527
8188+a, gdbSNP:373399151
8222+dbSNP:
8222+c, tdbSNP:148564401
8234+a, cdbSNP:139314793
8238+a, gdbSNP:201813972
8245+a, gdbSNP:149437604
8251+a, gdbSNP:143848658
8259+a, gdbSNP:55752583
8279+c, tdbSNP:148196343
8280+a, gdbSNP:142849878
8283+c, tdbSNP:12181
8293+a, gdbSNP:141199137
8300+c, tdbSNP:367779826
8306+c, tdbSNP:146227809
complement(8316)-t, cdbSNP:26107
8316+a, gdbSNP:386570466
8365+dbSNP:
8365+a, tdbSNP:144114662
8453+dbSNP:
8453+a, gdbSNP:73749289
8465+a, gdbSNP:149746078
8498+c, tdbSNP:139268252
8506+c, tdbSNP:56400458
8556+c, gdbSNP:377332779
8571+c, tdbSNP:373026400
8574+c, tdbSNP:145684552
8652+dbSNP:
8652+a, gdbSNP:372830683
8654+a, gdbSNP:377385359
8660..8661+, gdbSNP:34774288
8663+a, gdbSNP:148938868
8687+c, tdbSNP:200337620
8688+a, gdbSNP:137939835
8694+a, gdbSNP:376350332
8717+a, gdbSNP:182365882
8718+a, gdbSNP:373869398
8773+dbSNP:
8773+a, gdbSNP:200758734
8804+a, gdbSNP:201908582
8830+c, gdbSNP:377248579
8836+a, cdbSNP:145444034
8837+a, gdbSNP:143213427
8841+a, gdbSNP:147521780
8852+c, tdbSNP:200262568
8859+c, gdbSNP:142452362
8886+c, tdbSNP:200566283
8902+a, gdbSNP:201455780
8917+c, tdbSNP:369751194
8930+c, tdbSNP:188618696
8944+a, gdbSNP:201842117
8952+a, gdbSNP:372729569
8955+c, tdbSNP:199903389
8956+a, gdbSNP:146710788
8970+c, tdbSNP:55898643
8971+a, gdbSNP:373416203
8973+c, gdbSNP:148352486
9010+c, tdbSNP:201472442
9023+a, gdbSNP:55892819
9056+a, tdbSNP:376399006
9077+a, gdbSNP:202205709
9084+c, tdbSNP:200447498
9111+c, tdbSNP:369006273
9115+a, gdbSNP:369820818
9116+a, tdbSNP:55900671
9137+c, tdbSNP:375059973
9162+c, tdbSNP:367632509
9168+c, tdbSNP:150493969
9179+c, tdbSNP:201718893
9180+g, tdbSNP:138380178
9184+a, gdbSNP:149252703
9189+c, tdbSNP:145331937
9192+c, tdbSNP:369573593
9195+a, gdbSNP:73063533
9221+a, gdbSNP:202157396
9253+c, tdbSNP:61740945
9254+a, gdbSNP:200154985
9283+c, tdbSNP:145985294
9312+a, gdbSNP:369743344
complement(9381)-g, adbSNP:141909554
9512+a, gdbSNP:1058302
9562+a, tdbSNP:192969715
9563+a, tdbSNP:1058303
9679+c, tdbSNP:73752105
9740+a, gdbSNP:6554852
9772+c, tdbSNP:150609311
9780+c, gdbSNP:370596119
9794+c, tdbSNP:149948237
9795+a, gdbSNP:146031674
9816+a, gdbSNP:59086805
9938+c, gdbSNP:374722878
9974..9975+, tdbSNP:34668390
10036..10045+, tccccctgttdbSNP:200885754
Gene SymbolTRIO
Gene SynonymARHGEF23; tgat
Chromosome5
Locus Map5p15.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_007118 Homo sapiens trio Rho guanine nucleotide exchange factor (TRIO), mRNA. On-demand TBD TBD
XM_006714495 PREDICTED: Homo sapiens trio Rho guanine nucleotide exchange factor (TRIO), transcript variant X2, mRNA. On-demand TBD TBD
Title Genome-wide association study identifies ephrin type A receptors implicated in paclitaxel induced peripheral sensory neuropathy .
Author Leandro-Garcia LJ, Inglada-Perez L, Pita G, Hjerpe E, Leskela S, Jara C, Mielgo X, Gonzalez-Neira A, Robledo M, Avall-Lundqvist E, Green H and Rodriguez-Antona C.
Journal J. Med. Genet. 50 (9), 599-605 (2013)
Title A genome-wide RNAi screen reveals a Trio-regulated Rho GTPase circuitry transducing mitogenic signals initiated by G protein-coupled receptors .
Author Vaque JP, Dorsam RT, Feng X, Iglesias-Bartolome R, Forsthoefel DJ, Chen Q, Debant A, Seeger MA, Ksander BR, Teramoto H and Gutkind JS.
Journal Mol. Cell 49 (1), 94-108 (2013)
Title A genome-wide association study of chemotherapy-induced alopecia in breast cancer patients .
Author Chung,S., Low,S.K., Zembutsu,H., Takahashi,A., Kubo,M., Sasa,M. and Nakamura,Y.
Journal Breast Cancer Res. 15 (5), R81 (2013)
Title The Rho-guanine nucleotide exchange factor Trio controls leukocyte transendothelial migration by promoting docking structure formation .
Author van Rijssel J, Kroon J, Hoogenboezem M, van Alphen FP, de Jong RJ, Kostadinova E, Geerts D, Hordijk PL and van Buul JD.
Journal Mol. Biol. Cell 23 (15), 2831-2844 (2012)
Title The N-terminal DH-PH domain of Trio induces cell spreading and migration by regulating lamellipodia dynamics in a Rac1-dependent fashion .
Author van Rijssel J, Hoogenboezem M, Wester L, Hordijk PL and Van Buul JD.
Journal PLoS ONE 7 (1), E29912 (2012)
Title The trio guanine nucleotide exchange factor is a RhoA target. Binding of RhoA to the trio immunoglobulin-like domain .
Author Medley QG, Serra-Pages C, Iannotti E, Seipel K, Tang M, O'Brien SP and Streuli M.
Journal J. Biol. Chem. 275 (46), 36116-36123 (2000)
Title Trio amino-terminal guanine nucleotide exchange factor domain expression promotes actin cytoskeleton reorganization, cell migration and anchorage-independent cell growth .
Author Seipel K, Medley QG, Kedersha NL, Zhang XA, O'Brien SP, Serra-Pages C, Hemler ME and Streuli M.
Journal J. Cell. Sci. 112 (PT 12), 1825-1834 (1999)
Title NMR structure and mutagenesis of the N-terminal Dbl homology domain of the nucleotide exchange factor Trio .
Author Liu X, Wang H, Eberstadt M, Schnuchel A, Olejniczak ET, Meadows RP, Schkeryantz JM, Janowick DA, Harlan JE, Harris EA, Staunton DE and Fesik SW.
Journal Cell 95 (2), 269-277 (1998)
Title Assignment of TRIO, the Trio gene (PTPRF interacting) to human chromosome bands 5p 15.1-->p 14 by in situ hybridization .
Author Taviaux S, Diriong S, Bellanger JM, Streuli M and Debant A.
Journal Cytogenet. Cell Genet. 76 (1-2), 107-108 (1997)
Title The multidomain protein Trio binds the LAR transmembrane tyrosine phosphatase, contains a protein kinase domain, and has separate rac-specific and rho-specific guanine nucleotide exchange factor domains .
Author Debant A, Serra-Pages C, Seipel K, O'Brien S, Tang M, Park SH and Streuli M.
Journal Proc. Natl. Acad. Sci. U.S.A. 93 (11), 5466-5471 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.