• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens pre-B lymphocyte 1 (VPREB1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_007128 Homo sapiens pre-B lymphocyte 1 (VPREB1), mRNA. GenEZ ORF Cloning On-demand $299.00 14

*Business Day

Related Services

RefSeq Version NM_007128.2, 18379350
Length 641 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens pre-B lymphocyte 1 (VPREB1), mRNA.
Product immunoglobulin iota chain precursor
Comment

Summary: The protein encoded by this gene belongs to the immunoglobulin superfamily and is expressed selectively at the early stages of B cell development, namely, in proB and early preB cells. This gene encodes the iota polypeptide chain that is associated with the Ig-mu chain to form a molecular complex which is expressed on the surface of pre-B cells. The complex is thought to regulate Ig gene rearrangements in the early steps of B-cell differentiation. [provided by RefSeq, Oct 2008].


Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.

RefSeq NP_009059.1
CDS 27..464
Misc Feature(1)84..149
Misc Feature(2)114..380
Misc Feature(3)132..374
Misc Feature(4)150..194
Misc Feature(5)195..236
Misc Feature(6)237..269
Misc Feature(7)270..371
Exon (1)1..72
Gene:VPREB1
Gene Synonym:IGI; IGVPB; VPREB
Exon (2)73..641
Gene:VPREB1
Gene Synonym:IGI; IGVPB; VPREB
Translation MSWAPVLLMLFVYCTGCGPQPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQR PGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGAR SSEKEEREREWEEEMEPTAARTRVP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
16..17+dbSNP:
16..17+at, gcdbSNP:35044569
16+a, gdbSNP:11089977
17+c, tdbSNP:11089978
39+c, gdbSNP:146019843
93+dbSNP:
93+c, gdbSNP:201722357
95+a, gdbSNP:9619852
106+c, tdbSNP:142180774
111+a, gdbSNP:151193387
115+c, tdbSNP:199900999
119+a, gdbSNP:201207008
139+a, gdbSNP:139951133
173+c, tdbSNP:200837518
252+a, gdbSNP:1320
256+a, gdbSNP:147568280
264+a, gdbSNP:62640870
265+a, gdbSNP:144188550
275+c, gdbSNP:145423292
283+a, gdbSNP:149218137
300+a, gdbSNP:200057782
317+c, gdbSNP:188917401
322+a, tdbSNP:143361893
331+a, tdbSNP:201276189
335+c, tdbSNP:148339904
342+c, tdbSNP:17851581
362+a, gdbSNP:140610553
381+g, tdbSNP:111340500
384+c, tdbSNP:201713481
385+a, gdbSNP:200943449
389+c, tdbSNP:5995719
391+c, tdbSNP:11089979
420+a, gdbSNP:5995720
429+a, gdbSNP:200309974
463+a, gdbSNP:62640867
479+a, gdbSNP:6001563
490+c, tdbSNP:185445944
509+a, gdbSNP:113585988
523+c, tdbSNP:2285019
540+a, gdbSNP:140258192
633+c, tdbSNP:190303299
Gene SymbolVPREB1
Gene SynonymIGI; IGVPB; VPREB
Chromosome22
Locus Map22q11.22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_007128 Homo sapiens pre-B lymphocyte 1 (VPREB1), mRNA. On-demand $299.00 14
Title The potential role of VPREB1 gene copy number variation in susceptibility to rheumatoid arthritis .
Author Yim,S.H., Chung,Y.J., Jin,E.H., Shim,S.C., Kim,J.Y., Kim,Y.S., Hu,H.J., Shin,S.H., Pae,H.O., Zouali,M. and Chung,H.T.
Journal Mol. Immunol. 48 (11), 1338-1343 (2011)
Title New genetic associations detected in a host response study to hepatitis B vaccine .
Author Davila,S., Froeling,F.E., Tan,A., Bonnard,C., Boland,G.J., Snippe,H., Hibberd,M.L. and Seielstad,M.
Journal Genes Immun. 11 (3), 232-238 (2010)
Title Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening .
Author Wu,C., Ma,M.H., Brown,K.R., Geisler,M., Li,L., Tzeng,E., Jia,C.Y., Jurisica,I. and Li,S.S.
Journal Proteomics 7 (11), 1775-1785 (2007)
Title Clustering of pre-B cell integrins induces galectin-1-dependent pre-B cell receptor relocalization and activation .
Author Rossi,B., Espeli,M., Schiff,C. and Gauthier,L.
Journal J. Immunol. 177 (2), 796-803 (2006)
Title A genome annotation-driven approach to cloning the human ORFeome .
Author Collins,J.E., Wright,C.L., Edwards,C.A., Davis,M.P., Grinham,J.A., Cole,C.G., Goward,M.E., Aguado,B., Mallya,M., Mokrab,Y., Huckle,E.J., Beare,D.M. and Dunham,I.
Journal Genome Biol. 5 (10), R84 (2004)
Title Molecular components and assembly of mu.surrogate light chain complexes in pre-B cell lines .
Author Ohnishi,K. and Takemori,T.
Journal J. Biol. Chem. 269 (45), 28347-28353 (1994)
Title The human pre-B cell receptor: structural constraints for a tentative model of the pseudo-light (psi L) chain .
Author Guelpa-Fonlupt,V., Bossy,D., Alzari,P., Fumoux,F., Fougereau,M. and Schiff,C.
Journal Mol. Immunol. 31 (14), 1099-1108 (1994)
Title The products of pre-B cell-specific genes (lambda 5 and VpreB) and the immunoglobulin mu chain form a complex that is transported onto the cell surface .
Author Tsubata,T. and Reth,M.
Journal J. Exp. Med. 172 (3), 973-976 (1990)
Title Structure and pre-B lymphocyte restricted expression of the VpreB in humans and conservation of its structure in other mammalian species .
Author Bauer,S.R., Kudo,A. and Melchers,F.
Journal EMBO J. 7 (1), 111-116 (1988)
Title The human Vpre B gene is located on chromosome 22 near a cluster of .
Author Bauer,S.R., Huebner,K., Budarf,M., Finan,J., Erikson,J., Emanuel,B.S., Nowell,P.C., Croce,C.M. and Melchers,F.
Journal Immunogenetics 28 (5), 328-333 (1988)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.