• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens parkinson protein 7 (PARK7), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_007262 Homo sapiens parkinson protein 7 (PARK7), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $399.00 14

*Business Day

Related Services

RefSeq Version NM_007262.4, 183227676
Length 979 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens parkinson protein 7 (PARK7), transcript variant 1, mRNA.
Product protein DJ-1
Comment

Summary: The product of this gene belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript. Both variants 1 and 2 encode the same protein.

RefSeq NP_009193.2
CDS 164..733
Misc Feature(1)146..148
Misc Feature(2)176..715
Misc Feature(3)176..715
Misc Feature(4)179..679
Misc Feature(5)362..364
Misc Feature(6)362..364
Misc Feature(7)479..481
Misc Feature(8)479..481
Misc Feature(9)551..553
Exon (1)1..140
Gene:PARK7
Gene Synonym:DJ-1; DJ1
Exon (2)141..253
Gene:PARK7
Gene Synonym:DJ-1; DJ1
Exon (3)254..355
Gene:PARK7
Gene Synonym:DJ-1; DJ1
Exon (4)356..415
Gene:PARK7
Gene Synonym:DJ-1; DJ1
Exon (5)416..485
Gene:PARK7
Gene Synonym:DJ-1; DJ1
Exon (6)486..572
Gene:PARK7
Gene Synonym:DJ-1; DJ1
Exon (7)573..961
Gene:PARK7
Gene Synonym:DJ-1; DJ1
Translation MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLED AKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFG SKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQ VKAPLVLKD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
27+dbSNP:
27+a, gdbSNP:17523802
65..66+c, tdbSNP:11548935
65+c, tdbSNP:226249
84+a, tdbSNP:140230911
94+c, tdbSNP:11121064
142+dbSNP:
142+c, g, tdbSNP:11548933
153+a, gdbSNP:200286981
174+a, gdbSNP:190738218
212+a, c, gdbSNP:147698459
241+a, gdbSNP:74315351
246+a, gdbSNP:142405016
278+dbSNP:
278+g, tdbSNP:137853051
306+a, gdbSNP:145727915
329+a, gdbSNP:114601558
355+c, gdbSNP:74315353
360+dbSNP:
360+a, cdbSNP:145093684
361+a, gdbSNP:201258798
371+a, gdbSNP:200113696
397+c, tdbSNP:11548937
398+a, gdbSNP:45601537
409..410+, adbSNP:35566631
455+dbSNP:
455+c, tdbSNP:182164240
456+a, gdbSNP:71653619
461+a, gdbSNP:200696147
462+c, gdbSNP:199529022
464+c, gdbSNP:199719494
482+c, gdbSNP:145196092
491+dbSNP:
491+a, gdbSNP:45577037
557+a, gdbSNP:200894731
559+a, gdbSNP:200099666
563+a, gdbSNP:202097100
566+a, gdbSNP:201016410
581+dbSNP:
581+a, gdbSNP:199728189
592+a, gdbSNP:140517273
597+a, gdbSNP:148682310
609+a, cdbSNP:74315352
610+c, tdbSNP:144764347
629+c, tdbSNP:61772692
650+a, gdbSNP:74315354
660+c, tdbSNP:28938172
664+a, gdbSNP:71653621
697+a, gdbSNP:149974320
698+a, gdbSNP:71653622
715+a, cdbSNP:3203837
770+c, tdbSNP:199752316
817+a, tdbSNP:112196008
857+c, tdbSNP:147437667
920+c, tdbSNP:1044766
Gene SymbolPARK7
Gene SynonymDJ-1; DJ1
Chromosome1
Locus Map1p36.23
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001123377 Homo sapiens parkinson protein 7 (PARK7), transcript variant 2, mRNA. On-demand $399.00 14
NM_007262 Homo sapiens parkinson protein 7 (PARK7), transcript variant 1, mRNA. On-demand $399.00 14
Title Oxidized DJ-1 inhibits p53 by sequestering p53 from promoters in a DNA-binding affinity-dependent manner .
Author Kato,I., Maita,H., Takahashi-Niki,K., Saito,Y., Noguchi,N., Iguchi-Ariga,S.M. and Ariga,H.
Journal Mol. Cell. Biol. 33 (2), 340-359 (2013)
Title Peroxiredoxins and their expression in ependymomas .
Author Haapasalo,T., Nordfors,K., Jarvela,S., Kok,E., Sallinen,P., Kinnula,V.L., Haapasalo,H.K. and Soini,Y.
Journal J. Clin. Pathol. 66 (1), 12-17 (2013)
Title Comparative secretome analyses using a hollow fiber culture system with label-free quantitative proteomics indicates the influence of PARK7 on cell proliferation and migration/invasion in lung adenocarcinoma .
Author Chang,Y.H., Lee,S.H., Chang,H.C., Tseng,Y.L., Lai,W.W., Liao,C.C., Tsay,Y.G. and Liao,P.C.
Journal J. Proteome Res. 11 (11), 5167-5185 (2012)
Title Macrophage migration inhibitory factor and DJ-1 in gastric cancer: differences between high-incidence and low-incidence areas .
Author Shimwell,N.J., Ward,D.G., Mohri,Y., Mohri,T., Pallan,L., Teng,M., Miki,Y.C., Kusunoki,M., Tucker,O., Wei,W., Morse,J. and Johnson,P.J.
Journal Br. J. Cancer 107 (9), 1595-1601 (2012)
Title DJ-1 variants in Indian Parkinson's disease patients .
Author Sadhukhan,T., Biswas,A., Das,S.K., Ray,K. and Ray,J.
Journal Dis. Markers 33 (3), 127-135 (2012)
Title Mutations in the DJ-1 gene associated with autosomal recessive early-onset parkinsonism .
Author Bonifati,V., Rizzu,P., van Baren,M.J., Schaap,O., Breedveld,G.J., Krieger,E., Dekker,M.C., Squitieri,F., Ibanez,P., Joosse,M., van Dongen,J.W., Vanacore,N., van Swieten,J.C., Brice,A., Meco,G., van Duijn,C.M., Oostra,B.A. and Heutink,P.
Journal Science 299 (5604), 256-259 (2003)
Title DJ-1 positively regulates the androgen receptor by impairing the binding of PIASx alpha to the receptor .
Author Takahashi,K., Taira,T., Niki,T., Seino,C., Iguchi-Ariga,S.M. and Ariga,H.
Journal J. Biol. Chem. 276 (40), 37556-37563 (2001)
Title Park7, a novel locus for autosomal recessive early-onset parkinsonism, on chromosome 1p36 .
Author van Duijn,C.M., Dekker,M.C., Bonifati,V., Galjaard,R.J., Houwing-Duistermaat,J.J., Snijders,P.J., Testers,L., Breedveld,G.J., Horstink,M., Sandkuijl,L.A., van Swieten,J.C., Oostra,B.A. and Heutink,P.
Journal Am. J. Hum. Genet. 69 (3), 629-634 (2001)
Title Molecular cloning of human and mouse DJ-1 genes and identification of Sp1-dependent activation of the human DJ-1 promoter .
Author Taira,T., Takahashi,K., Kitagawa,R., Iguchi-Ariga,S.M. and Ariga,H.
Journal Gene 263 (1-2), 285-292 (2001)
Title DJ-1, a novel oncogene which transforms mouse NIH3T3 cells in cooperation with ras .
Author Nagakubo,D., Taira,T., Kitaura,H., Ikeda,M., Tamai,K., Iguchi-Ariga,S.M. and Ariga,H.
Journal Biochem. Biophys. Res. Commun. 231 (2), 509-513 (1997)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.