Homo sapiens breast cancer 1, early onset (BRCA1), transcript variant 1, mRNA.
| RefSeq Version | NM_007294.3, 237757283 |
| Length | 7224 bp |
| Structure | linear |
| Update Date | 13-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens breast cancer 1, early onset (BRCA1), transcript variant 1, mRNA. |
| Product | breast cancer type 1 susceptibility protein isoform 1 |
| Comment | Summary: This gene encodes a nuclear phosphoprotein that plays a role in maintaining genomic stability, and it also acts as a tumor suppressor. The encoded protein combines with other tumor suppressors, DNA damage sensors, and signal transducers to form a large multi-subunit protein complex known as the BRCA1-associated genome surveillance complex (BASC). This gene product associates with RNA polymerase II, and through the C-terminal domain, also interacts with histone deacetylase complexes. This protein thus plays a role in transcription, DNA repair of double-stranded breaks, and recombination. Mutations in this gene are responsible for approximately 40% of inherited breast cancers and more than 80% of inherited breast and ovarian cancers. Alternative splicing plays a role in modulating the subcellular localization and physiological function of this gene. Many alternatively spliced transcript variants, some of which are disease-associated mutations, have been described for this gene, but the full-length natures of only some of these variants has been described. A related pseudogene, which is also located on chromosome 17, has been identified. [provided by RefSeq]. Transcript Variant: This variant (1, also known as BRCA1a) represents the more frequently occurring transcript. It encodes the full-length BRCA1 protein (isoform 1), which is also known as p220. |
| RefSeq | NP_009225.1 |
| CDS | 233..5824 | Exon (1) | 1..213 | Exon (2) | 1..213 | Exon (3) | 214..312 | Exon (4) | 313..366 | Exon (5) | 367..444 | Exon (6) | 445..533 | Exon (7) | 534..673 | Exon (8) | 674..779 | Exon (9) | 780..825 | Exon (10) | 826..902 | Exon (11) | 903..4328 | Exon (12) | 4329..4417 | Exon (13) | 4418..4589 | Exon (14) | 4590..4716 | Exon (15) | 4717..4907 | Exon (16) | 4908..5218 | Exon (17) | 5219..5306 | Exon (18) | 5307..5384 | Exon (19) | 5385..5425 | Exon (20) | 5426..5509 | Exon (21) | 5510..5564 | Exon (22) | 5565..5638 | Exon (23) | 5639..5699 | Exon (24) | 5700..7207 |
| Translation | MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQ
CPLCKNDITKRSLQESTRFSQLVEELLKIICAFQLDTGLEYANSYNFAKKENNSPEHLKD
EVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYI
ELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDEISLDSAKKAACEFSETDVTNTEHHQ
PSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENSSLLLTKDRMNVE
KAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQKLPC
SENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHDGESESNAKVADVLDVLNEVD
EYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTEN
LIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAVQKTPEMINQGTNQTE
QNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPISSSISNMELELNI
HNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQMPV
RHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTSELKE
FVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTDYGTQ
ESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHS
RETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVT
FECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRG
NETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIP
STVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNRGPKL
NAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQPMGSS
HASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQ
GYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENL
LSLKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPFLIGS
SKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEAASGCESETSVSE
DCSGLSSQSDILTTQQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALE
DLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVERSSPSK
CPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSYLPRQDLEG
TPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSALKVPQLKVAESAQSPAAAHTT
DTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLI
TEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDV
VNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTL
GTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPH
SHY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Gene Symbol | BRCA1 |
| Gene Synonym | BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PSCP; RNF53 |
| Chromosome | 17 |
| Locus Map | 17q21 |
| All Transcripts | NM_007294 , NM_007298 , NM_007300 , NM_007297 , NM_007299 |
| Title | Emerging roles of BRCA1 alternative splicing . |
| Author | Orban,T.I. and Olah,E. |
| Journal | MP, Mol. Pathol. 56 (4), 191-197 (2003) |
| Title | Expression profiles of BRCA1 splice variants in asynchronous and in G1/S synchronized tumor cell lines . |
| Author | Orban,T.I. and Olah,E. |
| Journal | Biochem. Biophys. Res. Commun. 280 (1), 32-38 (2001) |
| Title | BRCA1: a review of structure and putative functions . |
| Author | Paterson,J.W. |
| Journal | Dis. Markers 13 (4), 261-274 (1998) |
| Title | Mutations and alternative splicing of the BRCA1 gene in UK breast/ovarian cancer families . |
| Author | Xu,C.F., Chambers,J.A., Nicolai,H., Brown,M.A., Hujeirat,Y., Mohammed,S., Hodgson,S., Kelsell,D.P., Spurr,N.K., Bishop,D.T. and Solomon,E. |
| Journal | Genes Chromosomes Cancer 18 (2), 102-110 (1997) |
| Title | Differential subcellular localization, expression and biological toxicity of BRCA1 and the splice variant BRCA1-delta11b . |
| Author | Wilson,C.A., Payton,M.N., Elliott,G.S., Buaas,F.W., Cajulis,E.E., Grosshans,D., Ramos,L., Reese,D.M., Slamon,D.J. and Calzone,F.J. |
| Journal | Oncogene 14 (1), 1-16 (1997) |
| Title | Localization of BRCA1 and a splice variant identifies the nuclear localization signal . |
| Author | Thakur,S., Zhang,H.B., Peng,Y., Le,H., Carroll,B., Ward,T., Yao,J., Farid,L.M., Couch,F.J., Wilson,R.B. and Weber,B.L. |
| Journal | Mol. Cell. Biol. 17 (1), 444-452 (1997) |
| Title | Characterization of functional messenger RNA splice variants of BRCA1 expressed in nonmalignant and tumor-derived breast cells . |
| Author | Lu,M., Conzen,S.D., Cole,C.N. and Arrick,B.A. |
| Journal | Cancer Res. 56 (20), 4578-4581 (1996) |
| Title | Growth retardation and tumour inhibition by BRCA1 . |
| Author | Holt,J.T., Thompson,M.E., Szabo,C., Robinson-Benion,C., Arteaga,C.L., King,M.C. and Jensen,R.A. |
| Journal | Nat. Genet. 12 (3), 298-302 (1996) |
| Title | Distinct transcription start sites generate two forms of BRCA1 mRNA . |
| Author | Xu,C.F., Brown,M.A., Chambers,J.A., Griffiths,B., Nicolai,H. and Solomon,E. |
| Journal | Hum. Mol. Genet. 4 (12), 2259-2264 (1995) |
| Title | A strong candidate for the breast and ovarian cancer susceptibility gene BRCA1 . |
| Author | Miki,Y., Swensen,J., Shattuck-Eidens,D., Futreal,P.A., Harshman,K., Tavtigian,S., Liu,Q., Cochran,C., Bennett,L.M., Ding,W. et al. |
| Journal | Science 266 (5182), 66-71 (1994) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
| Secured Online Quotation | |
| Email: gene@genscript.com | |
| Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 | |
| Fax: 1-732-210-0262 1-732-885-5878 |

