• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens breast cancer 1, early onset (BRCA1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_007294 Homo sapiens breast cancer 1, early onset (BRCA1), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $2699.00 30

*Business Day

Related Services

RefSeq Version NM_007294.3, 237757283
Length 7224 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens breast cancer 1, early onset (BRCA1), transcript variant 1, mRNA.
Product breast cancer type 1 susceptibility protein isoform 1
Comment

Summary: This gene encodes a nuclear phosphoprotein that plays a role in maintaining genomic stability, and it also acts as a tumor suppressor. The encoded protein combines with other tumor suppressors, DNA damage sensors, and signal transducers to form a large multi-subunit protein complex known as the BRCA1-associated genome surveillance complex (BASC). This gene product associates with RNA polymerase II, and through the C-terminal domain, also interacts with histone deacetylase complexes. This protein thus plays a role in transcription, DNA repair of double-stranded breaks, and recombination. Mutations in this gene are responsible for approximately 40% of inherited breast cancers and more than 80% of inherited breast and ovarian cancers. Alternative splicing plays a role in modulating the subcellular localization and physiological function of this gene. Many alternatively spliced transcript variants, some of which are disease-associated mutations, have been described for this gene, but the full-length natures of only some of these variants has been described. A related pseudogene, which is also located on chromosome 17, has been identified. [provided by RefSeq, May 2009].


Transcript Variant: This variant (1, also known as BRCA1a) represents the more frequently occurring transcript. It encodes the full-length BRCA1 protein (isoform 1), which is also known as p220.

RefSeq NP_009225.1
CDS 233..5824
Misc Feature(1)93
Misc Feature(2)209..211
Misc Feature(3)290..427
Misc Feature(4)290..427
Misc Feature(5)299..436
Misc Feature(6)order(302..304,311..313,347..349,353..355,362..364,
Misc Feature(7)572..574
Misc Feature(8)1154..1156
Misc Feature(9)1154..1156
Misc Feature(10)1262..1753
Misc Feature(11)1415..1417
Misc Feature(12)1424..1426
Misc Feature(13)1499..1501
Misc Feature(14)1757..1759
Misc Feature(15)2195..3166
Misc Feature(16)2312..2314
Misc Feature(17)2489..2491
Misc Feature(18)3194..3196
Misc Feature(19)3194..3196
Misc Feature(20)3659..3661
Misc Feature(21)3659..3661
Misc Feature(22)3695..3697
Misc Feature(23)3797..3799
Misc Feature(24)3863..3865
Misc Feature(25)3863..3865
Misc Feature(26)3866..3868
Misc Feature(27)3881..3883
Misc Feature(28)3881..3883
Misc Feature(29)3884..3886
Misc Feature(30)3884..3886
Misc Feature(31)3947..3949
Misc Feature(32)3965..3967
Misc Feature(33)4070..4072
Misc Feature(34)4070..4072
Misc Feature(35)4214..4216
Misc Feature(36)4220..4222
Misc Feature(37)4238..4240
Misc Feature(38)4238..4240
Misc Feature(39)4256..4258
Misc Feature(40)4256..4258
Misc Feature(41)4391..4393
Misc Feature(42)4391..4393
Misc Feature(43)4391..4393
Misc Feature(44)4412..4414
Misc Feature(45)4412..4414
Misc Feature(46)4421..4504
Misc Feature(47)4499..4501
Misc Feature(48)4499..4501
Misc Feature(49)4499..4501
Misc Feature(50)4601..4603
Misc Feature(51)4601..4603
Misc Feature(52)4601..4603
Misc Feature(53)4628..4630
Misc Feature(54)4721..4723
Misc Feature(55)4727..4729
Misc Feature(56)4802..4804
Misc Feature(57)4802..4804
Misc Feature(58)4802..4804
Misc Feature(59)4856..4858
Misc Feature(60)4946..4948
Misc Feature(61)5330..5332
Misc Feature(62)5390..5392
Misc Feature(63)5519..5758
Misc Feature(64)order(5564..5566,5576..5578,5585..5587,5594..5596,
Misc Feature(65)order(5741..5743,5753..5755)
Exon (1)1..213
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Exon (2)214..312
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Exon (3)313..366
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Exon (4)367..444
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Exon (5)445..533
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Exon (6)534..673
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Exon (7)674..779
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Exon (8)780..825
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Exon (9)826..902
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Exon (10)903..4328
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Exon (11)4329..4417
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Exon (12)4418..4589
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Exon (13)4590..4716
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Exon (14)4717..4907
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Exon (15)4908..5218
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Exon (16)5219..5306
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Exon (17)5307..5384
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Exon (18)5385..5425
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Exon (19)5426..5509
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Exon (20)5510..5564
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Exon (21)5565..5638
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Exon (22)5639..5699
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Exon (23)5700..7207
Gene:BRCA1
Gene Synonym:BRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Translation MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQ CPLCKNDITKRSLQESTRFSQLVEELLKIICAFQLDTGLEYANSYNFAKKENNSPEHLKD EVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYI ELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDEISLDSAKKAACEFSETDVTNTEHHQ PSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENSSLLLTKDRMNVE KAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQKLPC SENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHDGESESNAKVADVLDVLNEVD EYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTEN LIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAVQKTPEMINQGTNQTE QNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPISSSISNMELELNI HNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQMPV RHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTSELKE FVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTDYGTQ ESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHS RETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVT FECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRG NETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIP STVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNRGPKL NAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQPMGSS HASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQ GYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENL LSLKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPFLIGS SKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEAASGCESETSVSE DCSGLSSQSDILTTQQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALE DLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVERSSPSK CPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSYLPRQDLEG TPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSALKVPQLKVAESAQSPAAAHTT DTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLI TEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDV VNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTL GTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPH SHY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(41)-dbSNP:
complement(41)-g, adbSNP:113323025
complement(87)-, tdbSNP:8176075
complement(98..99)-, tdbSNP:35436937
complement(108)-g, adbSNP:148196794
complement(110)-c, adbSNP:190861568
complement(129..130)-, adbSNP:34191881
complement(137)-c, adbSNP:187992882
complement(147)-g, adbSNP:143160357
complement(219)-dbSNP:
complement(219)-t, cdbSNP:273897661
complement(222)-c, adbSNP:273897654
complement(230)-g, cdbSNP:273900720
complement(231)-t, adbSNP:273899693
complement(233)-g, adbSNP:80357287
complement(234)-t, g, cdbSNP:80357111
complement(235)-t, gdbSNP:80357475
complement(251..279)-, cgcgttgaagaagtacaaaatgtcattaadbSNP:80359871
complement(251)-t, cdbSNP:80356994
complement(252..260)-, gcgttgaagdbSNP:80359887
complement(252)-t, cdbSNP:144792613
complement(253)-g, adbSNP:149402012
complement(264..265)-, cdbSNP:80357811
complement(264)-t, cdbSNP:80357017
complement(266)-t, cdbSNP:80357134
complement(269..272)-, aatgdbSNP:80357530
complement(274)-c, adbSNP:80356827
complement(275)-c, adbSNP:80357031
complement(276)-t, cdbSNP:80357316
complement(285)-t, c, adbSNP:80356929
complement(292)-t, cdbSNP:202168814
complement(293)-g, adbSNP:80357406
complement(293)-, adbSNP:273902778
complement(296)-, tdbSNP:80357803
complement(297..298)-, ttdbSNP:80357642
complement(297)-t, cdbSNP:80357438
complement(298..299)-, ctdbSNP:199805151
complement(298..299)-, agdbSNP:80357713
complement(298..299)-, adbSNP:80357783
complement(301..311)-, gtgtcccatctdbSNP:80357696
complement(301..302)-, agdbSNP:80357914
complement(301)-, ctdbSNP:77944974
complement(302..312)-, tgtcccatctgdbSNP:80359877
complement(302..303)-, tgtc, adbSNP:80357536
complement(302)-t, cdbSNP:80357410
complement(303)-g, adbSNP:80357198
complement(305..306)-, ccdbSNP:80357633
complement(307)-t, cdbSNP:80356839
complement(310..311)-, catctgdbSNP:273902787
complement(315..316)-dbSNP:
complement(315..316)-, tgdbSNP:80357728
complement(315)-t, cdbSNP:80357266
complement(317)-t, gdbSNP:80357443
complement(325)-g, cdbSNP:80357000
complement(329)-g, cdbSNP:80357066
complement(333)-, cdbSNP:80357750
complement(339)-t, gdbSNP:183557525
complement(342)-g, c, adbSNP:80356880
complement(344..345)-, aadbSNP:80357949
complement(346)-t, g, adbSNP:1800062
complement(347)-t, c, adbSNP:80357164
complement(348)-g, adbSNP:80357498
complement(349..350)-, tgdbSNP:80357972
complement(354)-g, adbSNP:80357276
complement(356)-g, adbSNP:80357163
complement(356)-, adbSNP:80357943
complement(362)-, tdbSNP:80357951
complement(362)-t, adbSNP:80357327
complement(363)-t, g, adbSNP:80357446
complement(366)-c, adbSNP:80356863
complement(367)-dbSNP:
complement(367)-t, adbSNP:80356883
complement(371..372)-, tdbSNP:80357734
complement(371)-t, gdbSNP:80357370
complement(372)-t, gdbSNP:80357150
complement(375)-, tdbSNP:80357637
complement(376)-, gdbSNP:80357682
complement(378)-t, gdbSNP:273897660
complement(382)-, adbSNP:273897662
complement(386)-t, cdbSNP:80357084
complement(392)-t, cdbSNP:80356864
complement(398..399)-, gadbSNP:80357550
complement(403)-, gdbSNP:80357660
complement(408)-g, adbSNP:199522616
complement(410)-t, cdbSNP:80357471
complement(411)-, adbSNP:80357591
complement(413)-t, g, cdbSNP:28897672
complement(414)-g, adbSNP:80357093
complement(420)-t, adbSNP:80357086
complement(421..422)-, adbSNP:273897665
complement(421)-t, adbSNP:80356956
complement(422)-t, g, cdbSNP:80357064
complement(423)-g, adbSNP:55851803
complement(427)-, gdbSNP:80357869
complement(431)-t, gdbSNP:80357102
complement(433)-t, gdbSNP:80357033
complement(435..436)-, adbSNP:273898673
complement(435)-t, g, adbSNP:80357116
complement(438)-c, adbSNP:273898675
complement(443)-g, adbSNP:80357382
complement(444)-g, adbSNP:80356913
complement(448)-dbSNP:
complement(448)-c, adbSNP:80356967
complement(452)-t, cdbSNP:80357234
complement(456..459)-, aaagdbSNP:80357697
complement(462)-t, cdbSNP:80357209
complement(463)-t, gdbSNP:80356847
complement(464)-, adbSNP:80357884
complement(473)-t, cdbSNP:80357350
complement(475)-, adbSNP:273899684
complement(491)-t, gdbSNP:80357091
complement(498)-t, cdbSNP:80357097
complement(499)-g, cdbSNP:80356963
complement(501..513)-, tttgtgcttttcadbSNP:80359879
complement(501)-t, cdbSNP:80357174
complement(518)-g, adbSNP:80357110
complement(520)-g, adbSNP:146085503
complement(522..523)-, cadbSNP:80357738
complement(524)-t, g, cdbSNP:80357409
complement(535)-dbSNP:
complement(535)-t, gdbSNP:80356936
complement(537)-g, cdbSNP:80357190
complement(546)-g, adbSNP:28897673
complement(549)-, adbSNP:80357950
complement(553)-, tdbSNP:80357544
complement(561..562)-, agdbSNP:80357754
complement(561..562)-, adbSNP:80357604
complement(564)-c, adbSNP:80357312
complement(574..575)-, tcdbSNP:80357881
complement(598)-c, adbSNP:190900046
complement(602)-g, adbSNP:80357448
complement(604)-c, adbSNP:273900715
complement(612)-g, adbSNP:80357189
complement(621)-t, adbSNP:56055578
complement(622)-t, c, adbSNP:80356888
complement(623)-t, adbSNP:80357207
complement(628)-c, adbSNP:80357413
complement(629)-t, cdbSNP:80357457
complement(630..631)-, gtdbSNP:80357568
complement(630)-g, adbSNP:80357357
complement(638..639)-, adbSNP:80357709
complement(644..650)-, ctacagadbSNP:80357816
complement(645)-g, adbSNP:200449040
complement(647)-t, cdbSNP:80357372
complement(657)-c, adbSNP:55971303
complement(659)-t, g, adbSNP:80356991
complement(686)-dbSNP:
complement(686)-t, cdbSNP:41286288
complement(687)-t, cdbSNP:80357275
complement(688..689)-, cadbSNP:80357882
complement(689)-c, adbSNP:28897674
complement(695)-g, cdbSNP:80357180
complement(701)-t, cdbSNP:80356897
complement(702..703)-, ctdbSNP:80357887
complement(702)-g, cdbSNP:80357045
complement(710)-g, adbSNP:62625285
complement(716)-g, cdbSNP:55816927
complement(717..718)-, tgdbSNP:80357708
complement(722)-c, adbSNP:80357384
complement(725)-, cdbSNP:80357551
complement(726..727)-, tdbSNP:80357762
complement(735)-c, adbSNP:273901743
complement(737)-t, cdbSNP:80357133
complement(740)-t, cdbSNP:80357325
complement(741)-g, adbSNP:80357264
complement(746)-t, cdbSNP:80356947
complement(746)-, cdbSNP:80357872
complement(752)-, cdbSNP:80357639
complement(760)-g, adbSNP:34545365
complement(761)-, tdbSNP:80357758
complement(768)-g, adbSNP:56187033
complement(789)-dbSNP:
complement(789)-c, adbSNP:55688530
complement(799)-t, cdbSNP:80356845
complement(802)-g, adbSNP:201536070
complement(803)-g, adbSNP:80357090
complement(804)-t, adbSNP:80357142
complement(823)-t, cdbSNP:1799965
complement(833)-dbSNP:
complement(833)-g, adbSNP:80357109
complement(844)-g, cdbSNP:80357394
complement(858)-g, adbSNP:201596327
complement(869)-g, adbSNP:80357081
complement(873)-g, adbSNP:55680408
complement(887)-g, adbSNP:273902779
complement(893)-t, gdbSNP:80357088
complement(900..901)-, adbSNP:80357537
complement(900)-, adbSNP:80357745
complement(908)-dbSNP:
complement(908)-, tdbSNP:80357941
complement(915)-t, adbSNP:191872612
complement(917)-, tdbSNP:80357824
complement(924)-t, cdbSNP:80357001
complement(925)-g, adbSNP:62625298
complement(926)-g, adbSNP:55975699
complement(929..930)-, gtdbSNP:80357747
complement(939)-g, cdbSNP:80356990
complement(945)-t, adbSNP:144323891
complement(948)-g, adbSNP:80357396
complement(949)-t, gdbSNP:56310439
complement(954)-t, cdbSNP:80357351
complement(963)-, adbSNP:80357700
complement(965)-c, adbSNP:147519994
complement(966)-t, adbSNP:80356865
complement(968)-t, gdbSNP:28897675
complement(975)-c, adbSNP:80357062
complement(986)-t, cdbSNP:273902786
complement(987)-g, adbSNP:80357138
complement(989)-g, adbSNP:80357293
complement(995)-t, gdbSNP:80357009
complement(997)-g, adbSNP:62625299
complement(999)-c, adbSNP:11658785
complement(1005)-g, cdbSNP:80357225
complement(1007)-, gdbSNP:80357628
complement(1015)-t, gdbSNP:80357321
complement(1023..1026)-, gttcdbSNP:80357707
complement(1024)-t, gdbSNP:80357214
complement(1026..1027)-, ctdbSNP:80357955
complement(1027)-g, adbSNP:201441987
complement(1029..1030)-, ttdbSNP:80357789
complement(1030..1031)-, ttdbSNP:80357724
complement(1032)-g, cdbSNP:80357392
complement(1039)-t, cdbSNP:149867679
complement(1041)-, adbSNP:80357965
complement(1043)-g, c, adbSNP:80357244
complement(1054)-t, adbSNP:80357331
complement(1055)-g, adbSNP:8176153
complement(1059)-g, cdbSNP:80357436
complement(1060)-t, cdbSNP:186274774
complement(1067)-, cdbSNP:80357523
complement(1068)-g, adbSNP:80357482
complement(1071)-g, cdbSNP:80357199
complement(1074..1075)-, agdbSNP:80357792
complement(1075..1078)-, ctcadbSNP:80357919
complement(1080)-t, adbSNP:273902792
complement(1082..1083)-, tcattacdbSNP:80357989
complement(1083..1084)-, agdbSNP:80357719
complement(1083)-g, adbSNP:80357039
complement(1111)-c, adbSNP:139433219
complement(1114)-, adbSNP:80357587
complement(1121)-c, adbSNP:80357196
complement(1122)-t, adbSNP:80356924
complement(1123)-g, adbSNP:80357103
complement(1126..1127)-, tgdbSNP:80357759
complement(1127..1128)-, gtdbSNP:80357670
complement(1127..1128)-, aatgdbSNP:80357806
complement(1132)-c, adbSNP:80356861
complement(1134..1135)-, tdbSNP:80357726
complement(1136)-, gdbSNP:273903793
complement(1143)-, tdbSNP:80357622
complement(1154..1155)-, agdbSNP:80357644
complement(1154)-g, adbSNP:55767801
complement(1155)-, gdbSNP:80357953
complement(1158)-c, adbSNP:80356877
complement(1161)-, adbSNP:80357844
complement(1162)-, gdbSNP:80357689
complement(1175)-g, adbSNP:80357050
complement(1178)-g, adbSNP:55874646
complement(1181..1185)-, caacadbSNP:80357555
complement(1181)-t, cdbSNP:80357211
complement(1184..1247)-dbSNP:80359872
complement(1185..1186)-, tgdbSNP:80357690
complement(1194)-g, adbSNP:80357292
complement(1196)-, gdbSNP:273903794
complement(1196)-g, c, adbSNP:80357252
complement(1201)-t, adbSNP:45586033
complement(1212..1213)-, cadbSNP:80357610
complement(1213..1214)-, atdbSNP:80357772
complement(1213)-g, adbSNP:1800063
complement(1216..1217)-, cdbSNP:80357775
complement(1217)-t, adbSNP:140122807
complement(1225)-g, cdbSNP:80357140
complement(1226)-t, cdbSNP:80357176
complement(1227)-g, adbSNP:80357464
complement(1228)-t, gdbSNP:80356836
complement(1233)-t, cdbSNP:41286290
complement(1240..1241)-, tdbSNP:67284603
complement(1242..1243)-, adbSNP:80357563
complement(1242)-, adbSNP:80357911
complement(1247)-g, adbSNP:55842957
complement(1248..1249)-, adbSNP:80357569
complement(1248)-, adbSNP:80357618
complement(1250)-, gdbSNP:80357774
complement(1262)-g, adbSNP:79727659
complement(1265)-t, gdbSNP:80356961
complement(1268)-t, cdbSNP:80357015
complement(1277)-t, gdbSNP:80357338
complement(1286)-t, gdbSNP:80357472
complement(1290)-g, adbSNP:80356908
complement(1291)-g, adbSNP:80356935
complement(1296)-g, adbSNP:80357246
complement(1297)-g, adbSNP:41286292
complement(1298)-t, cdbSNP:80357215
complement(1299)-g, adbSNP:1799950
complement(1299)-, adbSNP:80357796
complement(1304)-, cdbSNP:80357836
complement(1313)-t, cdbSNP:80356946
complement(1314..1324)-, cagagaatcctdbSNP:80359880
complement(1318..1373)-dbSNP:80359875
complement(1318..1319)-, gadbSNP:80357897
complement(1320)-, adbSNP:80357954
complement(1333..1334)-, cdbSNP:80357665
complement(1334)-t, gdbSNP:80357139
complement(1337..1339)-, gatdbSNP:80358325
complement(1337)-g, adbSNP:56056711
complement(1338..1340)-, atgdbSNP:80358326
complement(1338)-g, adbSNP:80357416
complement(1348)-g, adbSNP:80357468
complement(1353..1355)-t, cacdbSNP:273897652
complement(1353)-t, cdbSNP:80357235
complement(1353)-, cdbSNP:80357612
complement(1359)-g, adbSNP:80356976
complement(1359)-, adbSNP:80357821
complement(1361..1362)-, adbSNP:80357776
complement(1362)-g, adbSNP:80357398
complement(1369)-t, gdbSNP:56128296
complement(1373)-t, adbSNP:80357385
complement(1394)-t, cdbSNP:111312760
complement(1397)-, adbSNP:80357985
complement(1398)-, gdbSNP:273897653
complement(1407..1446)-, tgttaggttctgatgactcacatgatggggagtctgaatcdbSNP:80359874
complement(1425)-g, cdbSNP:80357068
complement(1436)-t, gdbSNP:273897655
complement(1436)-, gdbSNP:80357859
complement(1440)-t, cdbSNP:80356934
complement(1446)-c, adbSNP:80357481
complement(1454)-g, adbSNP:80357253
complement(1457)-g, cdbSNP:144698700
complement(1459)-t, cdbSNP:149349675
complement(1463)-g, adbSNP:80357301
complement(1465)-t, gdbSNP:80357024
complement(1472..1478)-, gacgttcdbSNP:80357964
complement(1473..1474)-, adbSNP:80357514
complement(1482)-g, adbSNP:80357113
complement(1483)-t, gdbSNP:80357197
complement(1484)-t, gdbSNP:80357083
complement(1487)-, gdbSNP:80357535
complement(1490)-t, gdbSNP:80357488
complement(1493)-g, adbSNP:80357046
complement(1497..1498)-, adbSNP:80357809
complement(1498)-t, gdbSNP:80357417
complement(1508)-, tdbSNP:80357766
complement(1519..1520)-, adbSNP:80357576
complement(1524..1525)-, tdbSNP:80357528
complement(1524)-t, gdbSNP:80357346
complement(1529)-, gdbSNP:80357794
complement(1542)-c, adbSNP:80357255
complement(1551)-, tdbSNP:80357683
complement(1551)-t, cdbSNP:273897656
complement(1555..1556)-, atdbSNP:80357570
complement(1558..1559)-, gtdbSNP:80357543
complement(1565)-t, g, cdbSNP:80356915
complement(1567..1568)-, aadbSNP:80357978
complement(1572..1573)-, gdbSNP:80357597
complement(1584)-g, c, adbSNP:80356891
complement(1588)-, adbSNP:80357939
complement(1592..1593)-, agdbSNP:80357969
complement(1593)-g, adbSNP:80357181
complement(1599)-t, cdbSNP:80357360
complement(1612..1613)-, adbSNP:80357714
complement(1613)-t, cdbSNP:62625300
complement(1615)-, tdbSNP:80357879
complement(1615)-t, adbSNP:56046357
complement(1616)-g, adbSNP:80357221
complement(1618)-, gdbSNP:80357722
complement(1619)-, adbSNP:273897658
complement(1621..1622)-g, aadbSNP:273897659
complement(1622)-, adbSNP:80357770
complement(1623)-t, cdbSNP:62625301
complement(1624..1625)-, cdbSNP:80357592
complement(1628)-t, g, cdbSNP:80356964
complement(1629)-t, cdbSNP:199540030
complement(1631)-t, adbSNP:80357279
complement(1638)-g, cdbSNP:80357073
complement(1650)-t, g, adbSNP:80357057
complement(1653)-t, gdbSNP:80357490
complement(1659)-g, adbSNP:55720177
complement(1671..1672)-, adbSNP:80357505
complement(1672..1673)-, adbSNP:80357778
complement(1676..1679)-, attadbSNP:80357801
complement(1676)-, adbSNP:80357648
complement(1678..1680)-, tatdbSNP:80358327
complement(1680)-t, cdbSNP:80357489
complement(1682)-t, gdbSNP:80357304
complement(1688)-t, cdbSNP:55906931
complement(1690)-t, gdbSNP:80357400
complement(1694..1695)-, adbSNP:80357599
complement(1697)-g, adbSNP:80357167
complement(1703)-t, cdbSNP:62625303
complement(1704)-g, adbSNP:80357376
complement(1712)-t, cdbSNP:80357010
complement(1718)-t, c, adbSNP:28897676
complement(1719)-g, adbSNP:28897677
complement(1724)-, cdbSNP:80357527
complement(1729..1732)-, aaatdbSNP:80357632
complement(1734)-t, cdbSNP:113656989
complement(1736..1740)-, ttaaadbSNP:80357888
complement(1740)-g, adbSNP:62625304
complement(1740)-, adbSNP:80357506
complement(1742)-t, cdbSNP:80357445
complement(1742)-, cdbSNP:80357908
complement(1743..1744)-, gdbSNP:80357817
complement(1743)-g, adbSNP:56272539
complement(1750)-, gdbSNP:80357947
complement(1752)-t, gdbSNP:80357224
complement(1755)-, cdbSNP:80357782
complement(1756)-g, adbSNP:200616937
complement(1761)-g, cdbSNP:80357427
complement(1762)-, adbSNP:80357735
complement(1766)-t, cdbSNP:41286294
complement(1773)-g, cdbSNP:56100707
complement(1783)-, tdbSNP:80357630
complement(1788)-, adbSNP:80357662
complement(1793..1794)-gc, tadbSNP:273897663
complement(1793)-g, adbSNP:80357122
complement(1796)-g, adbSNP:80357453
complement(1803)-t, cdbSNP:80357333
complement(1805)-g, adbSNP:80357273
complement(1808)-t, cdbSNP:80356984
complement(1813)-g, cdbSNP:80357493
complement(1814..1820)-, actcctgdbSNP:80357613
complement(1832)-g, cdbSNP:142074233
complement(1833)-g, adbSNP:80357173
complement(1840..1843)-, taacdbSNP:80357698
complement(1844)-t, cdbSNP:80356893
complement(1848)-t, cdbSNP:80357374
complement(1853)-t, cdbSNP:80356904
complement(1862)-t, cdbSNP:80356952
complement(1868..1886)-, atgaatattactaatagtgdbSNP:80359881
complement(1874)-g, adbSNP:80356981
complement(1880..2092)-dbSNP:80359886
complement(1880)-c, adbSNP:56012641
complement(1881)-, adbSNP:80357619
complement(1906)-, adbSNP:80357600
complement(1908)-t, gdbSNP:80356980
complement(1919)-t, cdbSNP:80356898
complement(1927..1928)-, gdbSNP:273897664
complement(1932..1933)-, adbSNP:80357784
complement(1935)-t, g, cdbSNP:80356910
complement(1944)-t, cdbSNP:80357159
complement(1945..1949)-, agaatdbSNP:80357640
complement(1956)-t, cdbSNP:111539978
complement(1961..1962)-, gadbSNP:80357834
complement(1963)-g, adbSNP:28897678
complement(1965)-c, adbSNP:80356939
complement(1979)-t, g, adbSNP:80356928
complement(1988)-t, cdbSNP:80357153
complement(1989)-, cdbSNP:80357723
complement(2000)-g, adbSNP:80357454
complement(2004)-, tdbSNP:80357901
complement(2004)-t, cdbSNP:80356859
complement(2018)-t, g, cdbSNP:80357371
complement(2021)-t, g, adbSNP:55650082
complement(2025)-t, g, adbSNP:80357118
complement(2032)-g, cdbSNP:80357452
complement(2044)-, adbSNP:80357927
complement(2051)-t, adbSNP:80357220
complement(2053..2056)-, aaagdbSNP:80357585
complement(2055..2058)-, agaadbSNP:80357952
complement(2057)-, adbSNP:80357736
complement(2058)-g, adbSNP:80357236
complement(2066)-g, adbSNP:80357245
complement(2069)-, adbSNP:80357652
complement(2072)-t, adbSNP:80357282
complement(2078..2080)-, tctdbSNP:80358329
complement(2081)-g, adbSNP:45564238
complement(2097)-t, cdbSNP:56039126
complement(2098)-t, gdbSNP:1800064
complement(2102)-t, g, adbSNP:80356950
complement(2109..2110)-, tagtdbSNP:80357516
complement(2110)-g, adbSNP:8176154
complement(2111)-g, adbSNP:80357425
complement(2113..2116)-, cagtdbSNP:80357567
complement(2113)-g, cdbSNP:80356838
complement(2116)-t, gdbSNP:80357495
complement(2124..2125)-, tdbSNP:80357932
complement(2125..2126)-, tdbSNP:80357768
complement(2125)-g, adbSNP:80356834
complement(2127)-g, adbSNP:80356983
complement(2129)-t, c, adbSNP:80356902
complement(2130)-, cdbSNP:80357851
complement(2132)-t, cdbSNP:80357056
complement(2133)-g, cdbSNP:80357121
complement(2143)-t, cdbSNP:62625305
complement(2144)-t, g, adbSNP:80357005
complement(2144)-, gdbSNP:80357933
complement(2148)-t, adbSNP:80357267
complement(2156)-g, cdbSNP:80357344
complement(2159)-g, adbSNP:80357105
complement(2166)-c, adbSNP:80357129
complement(2177)-t, g, cdbSNP:80356907
complement(2184..2185)-, adbSNP:80357885
complement(2185..2188)-, gaaadbSNP:80357526
complement(2185..2186)-, gdbSNP:80357753
complement(2192..2193)-, aadbSNP:80357643
complement(2192)-t, adbSNP:80357355
complement(2193..2194)-, adbSNP:80357853
complement(2193)-, adbSNP:80357522
complement(2195)-t, gdbSNP:80357166
complement(2196)-t, adbSNP:80357193
complement(2203)-g, adbSNP:28897679
complement(2204)-g, adbSNP:55932871
complement(2206)-g, cdbSNP:55678461
complement(2217)-g, adbSNP:80357494
complement(2227)-g, cdbSNP:80357238
complement(2228)-, cdbSNP:80357922
complement(2231)-t, cdbSNP:80356889
complement(2233..2234)-, adbSNP:80357521
complement(2234)-t, cdbSNP:80357250
complement(2238)-t, cdbSNP:80356895
complement(2240)-g, adbSNP:80357029
complement(2249)-t, gdbSNP:80357391
complement(2249)-, gdbSNP:80357638
complement(2251)-, adbSNP:80357626
complement(2267)-t, adbSNP:80357082
complement(2270..2271)-, ccdbSNP:80357940
complement(2275)-c, adbSNP:143920945
complement(2291)-t, cdbSNP:273898674
complement(2292)-c, adbSNP:28897680
complement(2300)-, adbSNP:80357733
complement(2302..2303)-, aadbSNP:273898676
complement(2303)-, adbSNP:80357688
complement(2306)-, cdbSNP:80357554
complement(2309..2310)-, tadbSNP:80357595
complement(2309)-t, g, adbSNP:4986850
complement(2311..2312)-, cadbSNP:80357773
complement(2311)-t, cdbSNP:80356835
complement(2314)-t, cdbSNP:1799949
complement(2315)-t, g, adbSNP:28897681
complement(2318)-g, adbSNP:80357441
complement(2335)-g, adbSNP:273898677
complement(2337..2338)-, tdbSNP:80357880
complement(2337)-t, gdbSNP:80357298
complement(2341)-g, adbSNP:4986844
complement(2342..2343)-, aadbSNP:80357814
complement(2352)-g, adbSNP:80357192
complement(2355)-c, adbSNP:80357182
complement(2357..2358)-, adbSNP:80357871
complement(2362)-t, gdbSNP:273898678
complement(2370)-g, cdbSNP:80357233
complement(2374)-, tdbSNP:273898679
complement(2387..2388)-, adbSNP:80357715
complement(2387)-g, adbSNP:80357147
complement(2390)-t, g, adbSNP:80356875
complement(2399)-g, adbSNP:4986845
complement(2407)-t, cdbSNP:273898680
complement(2408)-, cdbSNP:80357668
complement(2412)-t, cdbSNP:80356912
complement(2415)-g, adbSNP:80357335
complement(2420..2433)-, gaaaaagaagagaadbSNP:273898681
complement(2420..2421)-, gdbSNP:80357566
complement(2420)-t, gdbSNP:80357058
complement(2425..2429)-, agaagdbSNP:80357507
complement(2426..2430)-, gaagadbSNP:80357755
complement(2426)-t, gdbSNP:80357426
complement(2427..2431)-, aagagdbSNP:80357771
complement(2429..2433)-, gagaadbSNP:80357539
complement(2431)-, gdbSNP:80357944
complement(2434)-, adbSNP:80357982
complement(2435)-, cdbSNP:80357936
complement(2438)-, gdbSNP:80357860
complement(2442..2443)-, cadbSNP:80357654
complement(2442)-, cdbSNP:80357793
complement(2446)-, tdbSNP:80357574
complement(2447..2448)-, ctdbSNP:80357930
complement(2447)-t, g, adbSNP:56329598
complement(2449..2450)-, adbSNP:80357802
complement(2449)-t, cdbSNP:200521980
complement(2450)-g, cdbSNP:80357415
complement(2454)-t, g, cdbSNP:80357051
complement(2464)-t, cdbSNP:4986846
complement(2468..2469)-, gdbSNP:80357909
complement(2473)-, cdbSNP:80357650
complement(2477)-t, gdbSNP:80357114
complement(2485..2486)-, gtdbSNP:80357602
complement(2488..2489)-, tadbSNP:80357557
complement(2495)-t, gdbSNP:41286296
complement(2495)-, gdbSNP:80357960
complement(2500)-g, cdbSNP:80356884
complement(2501)-, gdbSNP:80357583
complement(2505..2506)-, tdbSNP:80357681
complement(2507)-t, cdbSNP:80356999
complement(2514)-c, adbSNP:80356869
complement(2515..2516)-, aadbSNP:80357657
complement(2518)-t, adbSNP:273898682
complement(2525)-t, gdbSNP:80357449
complement(2526)-g, adbSNP:80357085
complement(2527)-t, cdbSNP:201875054
complement(2528..2529)-, agdbSNP:80357780
complement(2531)-g, adbSNP:80357194
complement(2531)-, adbSNP:80357786
complement(2541)-t, c, adbSNP:80357063
complement(2543)-t, cdbSNP:16940
complement(2546)-, gdbSNP:80357957
complement(2547)-t, cdbSNP:80357467
complement(2561)-, tdbSNP:80357725
complement(2563)-t, adbSNP:80357444
complement(2569..2570)-, tcdbSNP:80357515
complement(2570)-t, c, adbSNP:80356945
complement(2579)-g, adbSNP:80356948
complement(2582)-t, gdbSNP:80357399
complement(2583..2589)-, cgttactdbSNP:80357820
complement(2583)-t, cdbSNP:55914168
complement(2587..2588)-, adbSNP:80357990
complement(2591..2592)-, gdbSNP:80357739
complement(2594)-g, adbSNP:80357060
complement(2600)-g, adbSNP:41286298
complement(2608)-, gdbSNP:80357913
complement(2613)-g, adbSNP:7502059
complement(2619)-t, cdbSNP:80357364
complement(2621..2622)-, gadbSNP:80357695
complement(2621)-t, gdbSNP:62625306
complement(2622..2623)-, aadbSNP:80357546
complement(2625)-, cdbSNP:80357850
complement(2629)-t, adbSNP:80357203
complement(2633..2634)-, tgdbSNP:80357999
complement(2635)-t, adbSNP:80357381
complement(2637..2638)-, tgdbSNP:80357706
complement(2638..2641)-, gagtdbSNP:80357674
complement(2642)-t, cdbSNP:80356982
complement(2643..2644)-, agdbSNP:80357664
complement(2644)-g, cdbSNP:55746541
complement(2648)-g, adbSNP:80357144
complement(2651)-t, gdbSNP:80357240
complement(2652)-c, adbSNP:273899683
complement(2660)-t, adbSNP:28897682
complement(2665)-, cdbSNP:80357524
complement(2669)-t, gdbSNP:80357186
complement(2670..2671)-, gdbSNP:80357503
complement(2675)-, adbSNP:80357598
complement(2679)-g, adbSNP:80357108
complement(2682)-, gdbSNP:80357679
complement(2688)-g, cdbSNP:192655097
complement(2689)-, cdbSNP:80357669
complement(2690)-g, adbSNP:56082113
complement(2700)-, gdbSNP:80357799
complement(2705)-t, gdbSNP:80357328
complement(2706..2707)-, adbSNP:80357830
complement(2706)-t, adbSNP:80357249
complement(2707)-, cdbSNP:80357970
complement(2708)-, adbSNP:80357631
complement(2709..2710)-, cadbSNP:80357800
complement(2709)-, cdbSNP:80357740
complement(2709)-c, adbSNP:28897683
complement(2714)-g, adbSNP:80357185
complement(2715..2717)-, gctdbSNP:80358331
complement(2719)-, tdbSNP:80357658
complement(2721..2722)-, aadbSNP:273899685
complement(2739..2740)-, aadbSNP:273899686
complement(2745)-, adbSNP:80357863
complement(2747)-, cdbSNP:80357607
complement(2753)-t, cdbSNP:1800709
complement(2754)-g, adbSNP:80357337
complement(2757)-g, adbSNP:28897684
complement(2759)-g, adbSNP:80357435
complement(2763)-g, adbSNP:56051266
complement(2773)-g, adbSNP:80357195
complement(2777)-t, gdbSNP:80356951
complement(2789..2790)-, adbSNP:80357835
complement(2793..2794)-, gcdbSNP:80357968
complement(2793)-t, cdbSNP:80357315
complement(2795)-t, cdbSNP:80357131
complement(2798)-t, cdbSNP:80356892
complement(2800)-t, g, cdbSNP:80356832
complement(2814)-t, gdbSNP:80357098
complement(2816)-g, adbSNP:80356927
complement(2818..2825)-, ggtttcaadbSNP:80357675
complement(2822)-t, gdbSNP:80357285
complement(2823)-t, cdbSNP:80357003
complement(2824)-, adbSNP:80357756
complement(2828)-t, cdbSNP:41286300
complement(2829)-g, adbSNP:80356911
complement(2835)-g, cdbSNP:80356925
complement(2836..2837)-, gtcadbSNP:80357603
complement(2843..2844)-, ccdbSNP:80357962
complement(2844..2845)-, tdbSNP:80357948
complement(2844)-t, c, adbSNP:799917
complement(2848..2849)-, tdbSNP:80357912
complement(2864)-g, adbSNP:80357230
complement(2867)-t, g, adbSNP:80357251
complement(2876)-t, adbSNP:184374817
complement(2878..2880)-, tgcdbSNP:80357513
complement(2882)-g, adbSNP:80357120
complement(2890..2891)-, adbSNP:80357541
complement(2894)-t, cdbSNP:80357480
complement(2900)-g, adbSNP:80357200
complement(2901)-t, gdbSNP:80356874
complement(2902)-, gdbSNP:80357659
complement(2906)-g, adbSNP:137998759
complement(2907..2910)-, taaadbSNP:80357518
complement(2908..2911)-, aaagdbSNP:80357891
complement(2909)-c, adbSNP:80357170
complement(2911..2914)-, gaaadbSNP:80357596
complement(2913..2914)-, aadbSNP:80357971
complement(2917..2918)-, aadbSNP:80357636
complement(2918)-t, adbSNP:80357188
complement(2918)-, adbSNP:273899687
complement(2922..2923)-, adbSNP:80357549
complement(2924)-g, adbSNP:80357420
complement(2932..2933)-, ttdbSNP:80357899
complement(2939..2940)-, atdbSNP:80357717
complement(2941)-, tdbSNP:80357594
complement(2942)-t, gdbSNP:80357035
complement(2951..2954)-, gaagdbSNP:80357731
complement(2954)-t, gdbSNP:80356978
complement(2956..2960)-, aaatcdbSNP:80357712
complement(2957..2960)-, aatcdbSNP:80357917
complement(2958..2959)-, adbSNP:80357685
complement(2958)-t, adbSNP:80357127
complement(2958)-, adbSNP:80357614
complement(2959..2962)-, tcaadbSNP:80357605
complement(2965)-g, adbSNP:1800740
complement(2970)-t, cdbSNP:199954851
complement(2971)-t, adbSNP:273899688
complement(2972)-t, gdbSNP:80357419
complement(2975..2976)-, tcdbSNP:80357540
complement(2980..2981)-, adbSNP:80357942
complement(2990)-g, adbSNP:80357361
complement(2991)-t, cdbSNP:80357008
complement(2993)-t, cdbSNP:80357377
complement(2994)-, adbSNP:80357703
complement(2996..2999)-, acagdbSNP:80357822
complement(2997)-g, cdbSNP:80357460
complement(2998)-, adbSNP:80357812
complement(2999..3002)-, gttadbSNP:80357661
complement(3005)-g, c, adbSNP:4986847
complement(3014)-g, adbSNP:80356995
complement(3015)-t, cdbSNP:202004680
complement(3021)-t, cdbSNP:80357256
complement(3028..3031)-, tggtdbSNP:80357840
complement(3030)-g, adbSNP:80356941
complement(3031)-, tdbSNP:80357998
complement(3032)-t, cdbSNP:80357223
complement(3038..3041)-, gatadbSNP:80357832
complement(3044..3045)-g, ccdbSNP:273899689
complement(3046)-g, adbSNP:80356851
complement(3050)-t, gdbSNP:80357077
complement(3064)-t, adbSNP:80357458
complement(3066..3068)-, c, gtadbSNP:80358332
complement(3067..3068)-, tdbSNP:80357519
complement(3072..3073)-, aadbSNP:80357984
complement(3095..3099)-, tcatcdbSNP:80357819
complement(3096)-c, adbSNP:80357295
complement(3098..3102)-, tctcadbSNP:80357961
complement(3100)-, tdbSNP:80357929
complement(3101)-t, cdbSNP:80356973
complement(3103..3104)-, adbSNP:80357693
complement(3104)-t, adbSNP:80356878
complement(3115)-g, adbSNP:201190540
complement(3116)-g, adbSNP:80356955
complement(3119)-, adbSNP:80357559
complement(3121..3122)-, tgdbSNP:80357890
complement(3131)-t, adbSNP:273899690
complement(3142)-, adbSNP:80357893
complement(3143)-c, adbSNP:80357478
complement(3147)-, gdbSNP:80357573
complement(3149)-g, cdbSNP:80357080
complement(3150)-g, adbSNP:144569691
complement(3152..3153)-, ttdbSNP:80357611
complement(3153)-t, c, adbSNP:80356872
complement(3155)-t, cdbSNP:80357497
complement(3162)-g, adbSNP:141465583
complement(3163)-g, adbSNP:273899691
complement(3166)-, tdbSNP:80357741
complement(3166)-t, gdbSNP:80357115
complement(3167)-t, cdbSNP:80356970
complement(3168)-g, adbSNP:80356985
complement(3172)-, adbSNP:80357876
complement(3184)-, tdbSNP:80357627
complement(3198)-t, cdbSNP:4986848
complement(3211..3212)-, tdbSNP:34725869
complement(3212)-, tdbSNP:80357502
complement(3212)-g, adbSNP:144853230
complement(3222..3223)-, aadbSNP:80357829
complement(3227..3228)-ct, tadbSNP:273899692
complement(3227)-t, cdbSNP:80356848
complement(3230..3235)-, gaggaadbSNP:80358333
complement(3230)-g, adbSNP:80357124
complement(3231)-, adbSNP:80357991
complement(3234)-, adbSNP:80357601
complement(3237)-, adbSNP:80357846
complement(3240..3241)-, ttdbSNP:80357617
complement(3245)-, gdbSNP:80357937
complement(3248..3251)-, cattdbSNP:80357994
complement(3250..3253)-, ttcadbSNP:80357749
complement(3252)-g, cdbSNP:80357168
complement(3254)-g, adbSNP:56321129
complement(3256)-g, adbSNP:1800704
complement(3258)-c, adbSNP:273899696
complement(3261..3262)-, ctdbSNP:80357510
complement(3272)-t, g, adbSNP:80356933
complement(3273)-t, adbSNP:80357020
complement(3276..3277)-, gdbSNP:80357746
complement(3278)-g, adbSNP:80357154
complement(3279..3280)-, tgagadbSNP:80357866
complement(3281)-t, gdbSNP:80357004
complement(3284..3285)-, tgagadbSNP:80357856
complement(3285..3286)-, tgagadbSNP:80357547
complement(3287)-g, adbSNP:80357311
complement(3312)-g, adbSNP:80357386
complement(3314)-t, cdbSNP:80357049
complement(3315)-g, adbSNP:80357459
complement(3316..3326)-, taataacattadbSNP:80357647
complement(3329)-t, gdbSNP:273899698
complement(3332..3333)-, taacattagagaaadbSNP:80357967
complement(3336..3337)-, tdbSNP:273899699
complement(3339..3344)-, ttaaagdbSNP:80357920
complement(3340)-, tdbSNP:80357841
complement(3344)-t, gdbSNP:80357161
complement(3345)-g, adbSNP:16941
complement(3346..3349)-agcc, gadbSNP:273899700
complement(3351)-g, adbSNP:4986852
complement(3362)-g, adbSNP:80357271
complement(3375)-t, g, adbSNP:80356899
complement(3376)-t, cdbSNP:80356837
complement(3390..3391)-, gdbSNP:80357769
complement(3401)-g, adbSNP:80357479
complement(3410)-t, gdbSNP:80357424
complement(3411)-c, adbSNP:80357184
complement(3413)-, adbSNP:80357702
complement(3420..3421)-g, ccdbSNP:273899701
complement(3422)-t, adbSNP:273899702
complement(3425..3426)-, gdbSNP:80357511
complement(3426..3427)-, gdbSNP:80357883
complement(3443)-g, adbSNP:41293445
complement(3446)-, cdbSNP:80357923
complement(3452)-g, adbSNP:80357263
complement(3458)-, adbSNP:273899703
complement(3459)-g, cdbSNP:80357313
complement(3460..3461)-, agdbSNP:80357635
complement(3471)-t, adbSNP:80357145
complement(3485..3486)-, adbSNP:80357517
complement(3486..3487)-, adbSNP:80357625
complement(3487..3488)-, gadbSNP:80357624
complement(3488..3489)-, gadbSNP:80357764
complement(3489..3490)-, tdbSNP:80357858
complement(3489)-t, g, c, adbSNP:80357006
complement(3492)-g, cdbSNP:80357172
complement(3495)-t, adbSNP:80356901
complement(3500)-t, cdbSNP:80357402
complement(3518)-t, cdbSNP:80357485
complement(3518)-, cdbSNP:80357533
complement(3519)-g, adbSNP:273899704
complement(3520..3521)-, aadbSNP:80357686
complement(3524..3525)-, ctdbSNP:80357992
complement(3528)-t, cdbSNP:80357201
complement(3528)-, cdbSNP:80357815
complement(3534)-g, adbSNP:41293447
complement(3537)-g, adbSNP:80356900
complement(3540)-t, gdbSNP:80357135
complement(3541)-t, adbSNP:80357317
complement(3545)-c, adbSNP:80357288
complement(3548)-t, cdbSNP:45599040
complement(3551)-t, gdbSNP:80357106
complement(3552..3555)-, aaatdbSNP:80357763
complement(3557..3561)-, aaaaadbSNP:80357680
complement(3558..3561)-, aaaadbSNP:80357575
complement(3559..3561)-, aaadbSNP:80358334
complement(3559)-g, c, adbSNP:41293449
complement(3560..3563)-, aagcdbSNP:80357777
complement(3560..3562)-, aagdbSNP:80358335
complement(3561..3564)-, agcadbSNP:80357701
complement(3561..3562)-, agdbSNP:80357525
complement(3561..3562)-, adbSNP:80357692
complement(3562..3563)-, adbSNP:80357996
complement(3563..3566)-, caagdbSNP:80357903
complement(3563)-t, cdbSNP:80357089
complement(3565)-, adbSNP:80357966
complement(3571)-t, gdbSNP:80357421
complement(3572)-t, gdbSNP:80357278
complement(3575)-, gdbSNP:273899705
complement(3576..3578)-, aagdbSNP:80358336
complement(3578)-g, cdbSNP:55909400
complement(3583..3584)-, tdbSNP:80357785
complement(3586)-t, gdbSNP:80357334
complement(3587)-t, adbSNP:80356949
complement(3589)-, tdbSNP:80357827
complement(3590..3591)-, gtdbSNP:80357945
complement(3591..3592)-, ttdbSNP:80357843
complement(3594)-g, adbSNP:80356919
complement(3594)-, adbSNP:80357865
complement(3597..3598)-, cadbSNP:80357892
complement(3599)-t, gdbSNP:80356867
complement(3607..3608)-, tcdbSNP:80357828
complement(3609)-t, cdbSNP:80356887
complement(3621)-g, cdbSNP:80357405
complement(3622)-, adbSNP:80357900
complement(3629..3630)-, ttdbSNP:80357577
complement(3630)-t, adbSNP:80356971
complement(3632)-t, gdbSNP:80357018
complement(3635)-t, cdbSNP:80357136
complement(3639)-g, cdbSNP:80357329
complement(3642)-t, cdbSNP:80357297
complement(3648)-t, gdbSNP:80357228
complement(3649)-, tdbSNP:273899706
complement(3650..3652)-, agtdbSNP:80358337
complement(3650)-g, adbSNP:2227945
complement(3656)-g, cdbSNP:80357101
complement(3658)-g, adbSNP:80356843
complement(3660)-t, cdbSNP:80357434
complement(3662)-t, cdbSNP:80357369
complement(3664)-t, gdbSNP:80356922
complement(3669)-g, cdbSNP:80357247
complement(3674)-, gdbSNP:80357808
complement(3680)-t, cdbSNP:80357272
complement(3686)-g, adbSNP:80357175
complement(3694..3695)-, adbSNP:80357857
complement(3695)-g, cdbSNP:80357484
complement(3709..3712)-, aaagdbSNP:80357781
complement(3709..3711)-c, aaadbSNP:273899707
complement(3711..3721)-, aggaagatactdbSNP:80357910
complement(3713..3723)-, gaagatactagdbSNP:80357877
complement(3717)-, adbSNP:80357509
complement(3720)-t, cdbSNP:80356918
complement(3740)-t, adbSNP:273899708
complement(3742)-c, adbSNP:183119644
complement(3747)-g, adbSNP:80357206
complement(3759)-t, adbSNP:80357027
complement(3763)-, tdbSNP:80357621
complement(3773)-g, adbSNP:56336919
complement(3774)-t, cdbSNP:80357032
complement(3776)-t, cdbSNP:80357296
complement(3780..3781)-, aadbSNP:80357956
complement(3780)-g, adbSNP:16942
complement(3781..3782)-t, agdbSNP:273899709
complement(3792)-g, adbSNP:80356975
complement(3801..3802)-, ctdbSNP:80357845
complement(3812)-, adbSNP:80357663
complement(3813)-t, cdbSNP:80357290
complement(3813)-, cdbSNP:273900710
complement(3816)-g, adbSNP:28897685
complement(3818..3819)-, adbSNP:80357531
complement(3819)-t, c, adbSNP:80356944
complement(3825..3826)-, ttdbSNP:80357562
complement(3830)-t, cdbSNP:62625307
complement(3832)-t, g, cdbSNP:56214134
complement(3833)-g, adbSNP:55725337
complement(3835)-t, gdbSNP:80356830
complement(3839)-t, g, cdbSNP:62625308
complement(3840)-g, adbSNP:55930959
complement(3844)-, adbSNP:80357980
complement(3845)-g, adbSNP:80357294
complement(3851)-t, adbSNP:80357455
complement(3852..3853)-, adbSNP:80357926
complement(3854..3855)-, adbSNP:80357512
complement(3854)-g, adbSNP:80357152
complement(3857)-t, gdbSNP:273900711
complement(3858)-, tdbSNP:80357571
complement(3859..3860)-, adbSNP:80357729
complement(3861..3862)-, agdbSNP:80357589
complement(3868)-t, cdbSNP:148038877
complement(3872)-t, g, adbSNP:80356923
complement(3874..3875)-, gadbSNP:80357805
complement(3880..3881)-, adbSNP:80357902
complement(3881..3882)-, adbSNP:80357831
complement(3881)-t, cdbSNP:273900712
complement(3884)-t, g, adbSNP:80356894
complement(3887)-g, adbSNP:80356921
complement(3889)-g, cdbSNP:80356876
complement(3893)-t, gdbSNP:80357310
complement(3894)-c, adbSNP:273900713
complement(3896)-t, gdbSNP:80357356
complement(3903..3904)-, ttccdbSNP:80357797
complement(3908..3911)-, ttccdbSNP:80357671
complement(3913)-, tdbSNP:35999570
complement(3921)-t, gdbSNP:80357162
complement(3923)-t, cdbSNP:41293451
complement(3930)-g, adbSNP:80357141
complement(3931)-, adbSNP:80357873
complement(3932..3936)-, gtaaadbSNP:80357609
complement(3938..3945)-, aatataccdbSNP:80357552
complement(3938..3939)-, aadbSNP:80357666
complement(3940)-t, gdbSNP:28897687
complement(3942)-, tdbSNP:80357564
complement(3943)-g, adbSNP:80357388
complement(3945)-t, g, cdbSNP:28897688
complement(3946)-g, adbSNP:140777892
complement(3947..3949)-tct, cdbSNP:273900714
complement(3950)-t, cdbSNP:80356903
complement(3954..3972)-, ctactaggcatagcaccgtdbSNP:80359882
complement(3954)-c, adbSNP:80357143
complement(3956)-g, adbSNP:80357037
complement(3968)-, adbSNP:80357578
complement(3971)-g, adbSNP:80357191
complement(3978)-g, cdbSNP:80357099
complement(3980)-t, g, adbSNP:28897686
complement(3982)-g, cdbSNP:145903082
complement(3987..3990)-, tgtcdbSNP:80357963
complement(3988..3991)-, gtctdbSNP:80357868
complement(3991..3992)-, tdbSNP:80357687
complement(3991..3992)-, tadbSNP:80357520
complement(3991)-t, gdbSNP:80356852
complement(3992..3993)-, tdbSNP:80357986
complement(3992)-g, adbSNP:80357362
complement(3993..3994)-, ttdbSNP:80357928
complement(3993..3994)-, agdbSNP:80357645
complement(3996..3997)-, adbSNP:80357848
complement(3998..3999)-, adbSNP:80357704
complement(4001..4002)-, gadbSNP:80357579
complement(4002..4003)-, agdbSNP:80357993
complement(4003..4004)-, ggdbSNP:80357810
complement(4009)-, tdbSNP:80357798
complement(4010..4011)-, adbSNP:80357849
complement(4014)-, tdbSNP:80357545
complement(4015)-t, g, adbSNP:80356831
complement(4017)-t, c, adbSNP:80357269
complement(4026)-, adbSNP:80357767
complement(4029)-g, cdbSNP:80357160
complement(4030)-g, adbSNP:200648498
complement(4035)-g, adbSNP:273900716
complement(4036)-g, adbSNP:140588714
complement(4049)-t, cdbSNP:80357208
complement(4052..4053)-, gdbSNP:80357616
complement(4055)-g, adbSNP:80357280
complement(4062..4063)-, cdbSNP:80357878
complement(4067)-g, adbSNP:80357036
complement(4071..4075)-ctcag, aggcdbSNP:273900717
complement(4073..4075)-, cagdbSNP:80358338
complement(4073..4074)-, cadbSNP:80357584
complement(4073)-t, cdbSNP:80356866
complement(4074)-c, adbSNP:80357483
complement(4077)-t, adbSNP:80357217
complement(4080)-g, adbSNP:80357047
complement(4083)-g, adbSNP:80357499
complement(4088..4091)-, agtgdbSNP:80357842
complement(4088)-, adbSNP:80357855
complement(4089)-g, cdbSNP:142383077
complement(4090..4093)-, tgagdbSNP:80357889
complement(4094)-, gdbSNP:273900718
complement(4099..4103)-, aaaatdbSNP:80357560
complement(4100)-t, adbSNP:80357254
complement(4101..4102)-, aadbSNP:80357918
complement(4110)-t, c, adbSNP:80357213
complement(4123..4125)-, ttcdbSNP:80358339
complement(4125)-c, adbSNP:80357440
complement(4127)-t, cdbSNP:80357038
complement(4133..4134)-, agdbSNP:80357646
complement(4135)-t, adbSNP:273900719
complement(4136)-t, gdbSNP:80357461
complement(4140..4141)-, tdbSNP:80357634
complement(4148..4149)-, ttdbSNP:80357678
complement(4161)-c, adbSNP:80357257
complement(4163..4166)-, aacadbSNP:80357864
complement(4164)-, adbSNP:80357504
complement(4169)-t, cdbSNP:80357318
complement(4172)-g, adbSNP:80356954
complement(4176)-c, adbSNP:80357500
complement(4190)-t, cdbSNP:80356855
complement(4196)-t, adbSNP:80357343
complement(4197)-t, adbSNP:80357042
complement(4198)-, adbSNP:80357979
complement(4199)-t, cdbSNP:80357262
complement(4204)-, gdbSNP:80357987
complement(4205)-, adbSNP:80357904
complement(4225)-g, cdbSNP:70953658
complement(4243)-g, cdbSNP:80356886
complement(4244)-t, gdbSNP:12946486
complement(4247)-t, gdbSNP:80357021
complement(4258)-g, adbSNP:80356828
complement(4263)-g, adbSNP:55639854
complement(4267)-, adbSNP:80357711
complement(4268..4270)-, gaadbSNP:80358340
complement(4268)-g, adbSNP:80357407
complement(4269..4270)-, aadbSNP:273900721
complement(4271)-g, adbSNP:28897689
complement(4272)-g, adbSNP:80357210
complement(4273..4274)-, agdbSNP:80357727
complement(4277)-c, adbSNP:80357231
complement(4278)-t, cdbSNP:80357345
complement(4283)-g, adbSNP:139858874
complement(4284..4285)-, tdbSNP:80357779
complement(4286)-g, adbSNP:80357202
complement(4289)-t, gdbSNP:80357178
complement(4295..4297)-, aatdbSNP:80358341
complement(4297..4300)-, tcaadbSNP:80357508
complement(4306)-g, adbSNP:80356846
complement(4307)-t, cdbSNP:80357456
complement(4313)-c, adbSNP:80357218
complement(4317)-, adbSNP:80357737
complement(4342..4343)-dbSNP:
complement(4342..4343)-, tgdbSNP:80357529
complement(4343..4344)-, atctdbSNP:80357935
complement(4345)-t, cdbSNP:147448807
complement(4345)-, gdbSNP:80357861
complement(4347)-g, adbSNP:55848034
complement(4348..4349)-, tgdbSNP:80357804
complement(4349)-t, gdbSNP:80357259
complement(4352..4353)-, agdbSNP:80357787
complement(4354..4355)-, tgdbSNP:80357691
complement(4355)-t, gdbSNP:80357397
complement(4359)-g, cdbSNP:80356986
complement(4360..4361)-, aadbSNP:80357921
complement(4363)-c, adbSNP:80356871
complement(4364)-g, adbSNP:28897690
complement(4380)-g, cdbSNP:80357071
complement(4393..4394)-, tcdbSNP:80357565
complement(4395..4398)-, agagdbSNP:80357532
complement(4395..4396)-, adbSNP:80357788
complement(4397..4398)-, agdbSNP:80357572
complement(4398)-t, cdbSNP:78951648
complement(4399..4402)-, tgacdbSNP:80357538
complement(4399..4400)-, agdbSNP:80357847
complement(4415..4416)-, tcdbSNP:80357742
complement(4415)-t, cdbSNP:80357260
complement(4416)-g, adbSNP:80356972
complement(4417)-g, adbSNP:80356857
complement(4418)-dbSNP:
complement(4418)-t, cdbSNP:80357011
complement(4427..4428)-, acdbSNP:80357649
complement(4430)-g, adbSNP:80357306
complement(4431)-t, cdbSNP:80357473
complement(4436)-t, cdbSNP:80357365
complement(4437)-g, adbSNP:80356882
complement(4442)-, cdbSNP:80357765
complement(4443)-t, cdbSNP:80356916
complement(4445)-g, adbSNP:80357353
complement(4446)-, tdbSNP:273900728
complement(4450)-t, gdbSNP:1800707
complement(4452)-t, cdbSNP:80357492
complement(4454)-t, cdbSNP:80356989
complement(4464)-t, cdbSNP:273900729
complement(4475)-, gdbSNP:80357981
complement(4477)-g, adbSNP:41293453
complement(4483..4484)-, gtdbSNP:80357977
complement(4487)-g, cdbSNP:80357309
complement(4490)-t, cdbSNP:80357305
complement(4493)-t, cdbSNP:80357013
complement(4494)-g, adbSNP:80357079
complement(4517..4518)-, gdbSNP:80357716
complement(4520)-t, cdbSNP:80357466
complement(4521..4522)-, cdbSNP:80357556
complement(4526)-c, adbSNP:80357157
complement(4532..4533)-, adbSNP:80357790
complement(4540)-t, cdbSNP:1060915
complement(4546)-g, cdbSNP:80356856
complement(4553..4554)-, gdbSNP:80357748
complement(4559)-t, g, cdbSNP:41293455
complement(4560)-g, adbSNP:4986849
complement(4563..4570)-, atccagaadbSNP:80357825
complement(4571)-t, cdbSNP:80357067
complement(4574)-g, adbSNP:80357486
complement(4575)-g, adbSNP:80357354
complement(4579)-g, adbSNP:80356840
complement(4580..4581)-, tdbSNP:80357548
complement(4602)-dbSNP:
complement(4602)-g, cdbSNP:80357130
complement(4604..4620)-, cagaaaagtagtgaatadbSNP:80359885
complement(4604)-t, cdbSNP:80356932
complement(4616)-t, cdbSNP:141255461
complement(4621)-c, adbSNP:80356997
complement(4623..4635)-tt, ctataagccagaadbSNP:273900731
complement(4623..4625)-tt, ctadbSNP:273900730
complement(4623)-, cdbSNP:80357916
complement(4634)-c, adbSNP:80357022
complement(4637)-t, cdbSNP:80356960
complement(4642)-t, adbSNP:80357075
complement(4646)-g, adbSNP:200582930
complement(4682)-t, adbSNP:80357404
complement(4686)-t, cdbSNP:80356870
complement(4692)-g, adbSNP:80357126
complement(4695..4696)-, adbSNP:80357620
complement(4700)-c, adbSNP:138608489
complement(4703)-c, adbSNP:111034213
complement(4712)-t, g, adbSNP:80357148
complement(4714..4715)-, aadbSNP:80357854
complement(4716)-t, g, adbSNP:80357389
complement(4719)-dbSNP:
complement(4719)-g, c, adbSNP:80356953
complement(4736)-t, cdbSNP:80357383
complement(4737)-t, cdbSNP:56335406
complement(4740)-c, adbSNP:80357437
complement(4748)-, gdbSNP:273900736
complement(4750)-g, adbSNP:73983787
complement(4752)-g, cdbSNP:80357470
complement(4756)-g, adbSNP:80356885
complement(4765..4766)-, cadbSNP:80357534
complement(4766)-t, adbSNP:80357137
complement(4767)-t, gdbSNP:1800744
complement(4781)-g, adbSNP:137894496
complement(4784)-t, cdbSNP:80356881
complement(4797)-g, adbSNP:80357379
complement(4806..4807)-, aadbSNP:80357813
complement(4811)-g, adbSNP:80357237
complement(4817)-g, adbSNP:80357095
complement(4826..4827)-, tcdbSNP:80357826
complement(4827..4828)-, ctdbSNP:80357699
complement(4832)-g, adbSNP:55815649
complement(4835)-t, gdbSNP:80357366
complement(4841)-t, cdbSNP:80357229
complement(4842)-g, adbSNP:70953659
complement(4843..4844)-, gdbSNP:80357915
complement(4844)-t, cdbSNP:80356992
complement(4850)-t, gdbSNP:80357277
complement(4853)-t, gdbSNP:80357248
complement(4857..4858)-, ctdbSNP:80357542
complement(4857)-g, cdbSNP:41293457
complement(4863)-t, cdbSNP:80356917
complement(4868)-t, g, adbSNP:28897691
complement(4875)-t, cdbSNP:273900737
complement(4876)-g, adbSNP:28897692
complement(4881)-t, cdbSNP:80357076
complement(4887..4890)-, acttdbSNP:80357561
complement(4888)-g, cdbSNP:80357151
complement(4889)-t, adbSNP:80357431
complement(4901)-g, cdbSNP:80356906
complement(4907)-g, c, adbSNP:80356988
complement(4910)-dbSNP:
complement(4910)-t, gdbSNP:80357349
complement(4914)-t, cdbSNP:56158747
complement(4915)-t, cdbSNP:55688400
complement(4917)-t, cdbSNP:80357096
complement(4921)-g, cdbSNP:80357433
complement(4923)-t, cdbSNP:56119278
complement(4934)-g, adbSNP:80357119
complement(4940)-g, adbSNP:147703239
complement(4944..4948)-, tctctdbSNP:80357718
complement(4944)-t, cdbSNP:273901740
complement(4956)-c, adbSNP:80357052
complement(4961)-t, cdbSNP:80356909
complement(4962)-c, adbSNP:273901741
complement(4965)-g, adbSNP:80356930
complement(4967)-g, cdbSNP:145466894
complement(4971)-t, cdbSNP:80357411
complement(4977)-, adbSNP:80357907
complement(4981..4982)-, agdbSNP:80357641
complement(4982)-t, gdbSNP:80357070
complement(4986..4987)-, cadbSNP:80357837
complement(4996..4997)-, tcdbSNP:80357795
complement(4997)-t, cdbSNP:80357002
complement(4998)-g, adbSNP:80357341
complement(5019)-t, cdbSNP:80357429
complement(5021)-g, adbSNP:80357187
complement(5030..5044)-, ttgaaagttccccaadbSNP:80359888
complement(5033)-t, adbSNP:80357303
complement(5042)-t, cdbSNP:80357352
complement(5043)-g, adbSNP:80357439
complement(5044)-g, adbSNP:28897693
complement(5045)-t, g, cdbSNP:80356833
complement(5048)-g, adbSNP:80356943
complement(5055)-t, cdbSNP:80357072
complement(5065)-t, cdbSNP:80356842
complement(5069)-t, g, adbSNP:1799966
complement(5072)-t, cdbSNP:70953660
complement(5075..5076)-, gdbSNP:80357615
complement(5075)-g, adbSNP:80356987
complement(5077)-g, adbSNP:144588397
complement(5090)-g, adbSNP:8176219
complement(5100)-g, cdbSNP:80356862
complement(5104)-t, gdbSNP:11555992
complement(5114)-g, adbSNP:80357465
complement(5115)-t, cdbSNP:4986854
complement(5116)-t, gdbSNP:80357158
complement(5123..5124)-, adbSNP:80357656
complement(5124)-g, adbSNP:273901742
complement(5125)-t, cdbSNP:80356850
complement(5135)-t, cdbSNP:200432771
complement(5142)-t, cdbSNP:80357048
complement(5153)-g, c, adbSNP:1800726
complement(5163)-g, adbSNP:80357016
complement(5165..5166)-, aadbSNP:80357833
complement(5165)-g, adbSNP:80356926
complement(5166)-t, g, cdbSNP:70953661
complement(5166)-, gdbSNP:80357653
complement(5167)-g, cdbSNP:80357373
complement(5168)-, gdbSNP:80357705
complement(5169)-t, adbSNP:28897694
complement(5173)-, cdbSNP:80357905
complement(5173)-c, adbSNP:80357302
complement(5174)-, adbSNP:80357761
complement(5175)-t, cdbSNP:201810810
complement(5176..5177)-, aadbSNP:80357655
complement(5184)-t, cdbSNP:80356938
complement(5187)-t, cdbSNP:80356968
complement(5188)-g, adbSNP:1799967
complement(5189)-g, adbSNP:80357261
complement(5196..5214)-, ctggcctgaccccagaagadbSNP:80359876
complement(5196)-t, cdbSNP:80357390
complement(5198..5216)-, ggcctgaccccagaagaatdbSNP:80359884
complement(5199)-g, adbSNP:80357414
complement(5213)-t, gdbSNP:80357401
complement(5217)-t, g, cdbSNP:28897695
complement(5219)-dbSNP:
complement(5219)-t, adbSNP:80357117
complement(5220)-t, adbSNP:80357205
complement(5223)-t, cdbSNP:80357314
complement(5224)-g, adbSNP:142459158
complement(5225)-g, adbSNP:80357169
complement(5231)-t, adbSNP:80357204
complement(5237)-t, gdbSNP:80357087
complement(5237)-, gdbSNP:80357938
complement(5249..5251)-, cacdbSNP:80358343
complement(5256)-g, adbSNP:150729791
complement(5258..5268)-, ttaactaatctdbSNP:80357894
complement(5259..5262)-, taacdbSNP:80357580
complement(5260..5263)-, aactdbSNP:80357924
complement(5262..5265)-, ctaadbSNP:80357862
complement(5267..5271)-, ctaatdbSNP:80357623
complement(5267)-, cdbSNP:80357896
complement(5272)-, tdbSNP:80357673
complement(5276)-g, adbSNP:80356958
complement(5277)-t, adbSNP:80357265
complement(5279)-t, gdbSNP:80356879
complement(5285)-g, adbSNP:80356890
complement(5286)-t, cdbSNP:80357043
complement(5288..5289)-, cdbSNP:80357974
complement(5294..5296)-, gttdbSNP:80358344
complement(5298)-t, g, cdbSNP:80357061
complement(5303..5304)-, adbSNP:80357672
complement(5304)-t, c, adbSNP:80357034
complement(5305)-g, adbSNP:80356853
complement(5306)-t, g, c, adbSNP:80187739
complement(5309..5311)-dbSNP:
complement(5309..5311)-, gctdbSNP:80358345
complement(5312)-t, gdbSNP:80356896
complement(5316..5317)-, ttdbSNP:80357760
complement(5317)-t, adbSNP:80357387
complement(5318)-g, cdbSNP:80357125
complement(5321)-t, cdbSNP:80356993
complement(5323..5324)-, tgdbSNP:80357710
complement(5327)-t, cdbSNP:55770810
complement(5328)-t, g, c, adbSNP:41293459
complement(5332)-g, adbSNP:45519437
complement(5334..5335)-, tgdbSNP:80357608
complement(5338)-, adbSNP:80357553
complement(5341)-t, gdbSNP:80356974
complement(5345)-t, g, cdbSNP:80356858
complement(5349)-g, c, adbSNP:80356860
complement(5355)-t, c, adbSNP:28897696
complement(5358)-, gdbSNP:80357874
complement(5368)-g, adbSNP:80357418
complement(5369)-, gdbSNP:80357997
complement(5370)-t, cdbSNP:80357132
complement(5373)-t, gdbSNP:80357243
complement(5375)-t, c, adbSNP:80357222
complement(5376)-g, adbSNP:45444999
complement(5377)-g, c, adbSNP:80357094
complement(5377)-, cdbSNP:80357870
complement(5382)-, tdbSNP:80357720
complement(5385)-dbSNP:
complement(5385)-g, c, adbSNP:41293461
complement(5386)-t, g, adbSNP:80357239
complement(5387)-, gdbSNP:80357743
complement(5388..5389)-, tgdbSNP:80357895
complement(5389)-t, gdbSNP:28897697
complement(5390)-g, adbSNP:56195342
complement(5393..5395)-, cagdbSNP:80358346
complement(5397)-t, cdbSNP:80357104
complement(5405..5408)-, gaaadbSNP:80357867
complement(5405)-t, gdbSNP:80357291
complement(5407)-t, cdbSNP:191373374
complement(5408)-g, adbSNP:80357501
complement(5409..5412)-, gaaadbSNP:80357975
complement(5409..5410)-, gadbSNP:80357730
complement(5411)-t, adbSNP:80357347
complement(5414..5415)-, tdbSNP:34570933
complement(5421)-g, adbSNP:80357171
complement(5430)-dbSNP:
complement(5430)-g, adbSNP:80357270
complement(5432)-t, cdbSNP:80356957
complement(5439)-t, g, cdbSNP:45553935
complement(5441..5480)-tc, agaggagatgtggtcaatggaagaaaccaccaaggtccaadbSNP:273901753
complement(5441)-t, adbSNP:80357496
complement(5444)-g, adbSNP:80356937
complement(5445..5447)-, gagdbSNP:80358347
complement(5445)-g, adbSNP:80357450
complement(5447)-t, gdbSNP:80357283
complement(5448)-g, adbSNP:80357227
complement(5449)-t, gdbSNP:80357340
complement(5454)-t, gdbSNP:80357023
complement(5461..5462)-, aadbSNP:80357852
complement(5468)-c, adbSNP:80357146
complement(5471)-t, cdbSNP:80357367
complement(5473)-, adbSNP:80357791
complement(5475)-, gdbSNP:80357676
complement(5478)-g, cdbSNP:80357462
complement(5483)-t, cdbSNP:80357123
complement(5484)-g, c, adbSNP:80357442
complement(5486)-g, cdbSNP:80357074
complement(5487)-t, cdbSNP:80357028
complement(5488)-c, adbSNP:80356844
complement(5491)-, adbSNP:80357925
complement(5492)-t, gdbSNP:80357432
complement(5495..5496)-, cdbSNP:80357906
complement(5498)-, cdbSNP:76171189
complement(5506)-, adbSNP:80357732
complement(5509)-g, adbSNP:80356854
complement(5514)-dbSNP:
complement(5514)-t, cdbSNP:80356905
complement(5516)-, adbSNP:80357684
complement(5517..5518)-, gdbSNP:80357886
complement(5520)-t, gdbSNP:80357007
complement(5521)-g, cdbSNP:144061758
complement(5523)-t, cdbSNP:80357281
complement(5529)-t, gdbSNP:80357463
complement(5536)-g, adbSNP:138493864
complement(5536)-, cdbSNP:80357959
complement(5540)-, gdbSNP:80357581
complement(5542)-g, adbSNP:273901761
complement(5544)-t, g, cdbSNP:80357025
complement(5549)-t, adbSNP:80357324
complement(5550)-t, cdbSNP:80357428
complement(5551..5552)-, cdbSNP:80357823
complement(5552..5553)-, aadbSNP:80357818
complement(5556)-t, g, adbSNP:41293463
complement(5558)-t, cdbSNP:1800757
complement(5560..5561)-, cdbSNP:80357751
complement(5564)-g, adbSNP:80357112
complement(5565)-dbSNP:
complement(5565)-g, adbSNP:80357041
complement(5567)-, cdbSNP:80357590
complement(5571)-t, cdbSNP:80357474
complement(5573)-, gdbSNP:80357694
complement(5577)-g, adbSNP:80357219
complement(5578)-g, adbSNP:80357284
complement(5579)-c, adbSNP:80357012
complement(5580)-t, cdbSNP:55808233
complement(5584..5585)-, adbSNP:80357744
complement(5585)-t, cdbSNP:80356969
complement(5591)-t, adbSNP:80357065
complement(5595)-t, g, adbSNP:80357069
complement(5597)-t, gdbSNP:80357078
complement(5602..5629)-, tgtggtgaaggagctttcatcattcaccdbSNP:80359878
complement(5603)-c, adbSNP:145758886
complement(5615..5616)-, tdbSNP:80357838
complement(5619)-c, adbSNP:80357055
complement(5640)-dbSNP:
complement(5640)-g, cdbSNP:80357149
complement(5643)-t, adbSNP:80356920
complement(5648)-g, cdbSNP:80357241
complement(5649)-, cdbSNP:80357558
complement(5650)-, adbSNP:80357934
complement(5655)-t, cdbSNP:80357358
complement(5657..5662)-, gttgtgdbSNP:80358348
complement(5657)-t, gdbSNP:28897698
complement(5658)-t, cdbSNP:80357216
complement(5661)-t, gdbSNP:80357451
complement(5664)-g, adbSNP:80357040
complement(5665)-g, adbSNP:4438367
complement(5666)-t, g, cdbSNP:1800751
complement(5672)-, gdbSNP:80357946
complement(5676)-g, adbSNP:80356962
complement(5681)-t, gdbSNP:80356868
complement(5685)-g, adbSNP:80357477
complement(5688)-g, adbSNP:80357286
complement(5696..5697)-, tdbSNP:273902769
complement(5699)-g, adbSNP:80357212
complement(5702..5709)-dbSNP:
complement(5702..5709)-, attgggcadbSNP:80357973
complement(5703)-t, adbSNP:70953662
complement(5710)-t, gdbSNP:80357332
complement(5711..5712)-, gadbSNP:80357757
complement(5720)-g, adbSNP:80357393
complement(5722)-, adbSNP:80357976
complement(5724)-, cdbSNP:80357582
complement(5728..5738)-ggtgacccgag, adbSNP:273902775
complement(5729)-g, adbSNP:80357268
complement(5730..5743)-, tgacccgagagtggdbSNP:80359873
complement(5735..5796)-dbSNP:80359883
complement(5735)-t, cdbSNP:41293465
complement(5736)-g, adbSNP:273902776
complement(5738)-t, g, adbSNP:80356942
complement(5741)-t, g, cdbSNP:80356959
complement(5742)-, gdbSNP:80357839
complement(5742)-g, adbSNP:80357307
complement(5743)-t, g, adbSNP:80356914
complement(5745)-t, adbSNP:80357107
complement(5753)-c, adbSNP:80357299
complement(5753)-, adbSNP:80357721
complement(5754)-g, adbSNP:80357368
complement(5759)-g, cdbSNP:80357019
complement(5763)-t, gdbSNP:80357323
complement(5764)-t, cdbSNP:80356829
complement(5767)-c, adbSNP:80356977
complement(5768)-t, cdbSNP:80356873
complement(5770)-g, adbSNP:80356849
complement(5785)-c, adbSNP:80357326
complement(5788)-g, cdbSNP:80356841
complement(5790..5791)-, adbSNP:80357629
complement(5790)-g, adbSNP:80357258
complement(5791)-c, adbSNP:80357336
complement(5793)-t, cdbSNP:80356996
complement(5798)-t, cdbSNP:80357274
complement(5803)-t, gdbSNP:28897699
complement(5806)-g, cdbSNP:150199718
complement(5808)-g, cdbSNP:80357322
complement(5811)-t, gdbSNP:201196020
complement(5812..5813)-, gggggggggdbSNP:138690298
complement(5817)-t, adbSNP:80357183
complement(5860)-g, cdbSNP:3092995
complement(5882)-g, adbSNP:137892861
complement(5930)-g, c, adbSNP:189442183
complement(6052)-t, cdbSNP:56108540
complement(6096)-g, adbSNP:8176317
complement(6245)-t, gdbSNP:8176318
complement(6406)-g, adbSNP:141850147
complement(6574)-t, cdbSNP:138782023
complement(6602)-g, cdbSNP:11655841
complement(6605)-t, cdbSNP:8176319
complement(6696..6697)-, t, ttdbSNP:59541324
complement(6697)-, tdbSNP:33947868
complement(6713)-t, cdbSNP:55834099
complement(6715)-t, cdbSNP:56056327
complement(6718)-g, adbSNP:1060920
complement(6724)-t, adbSNP:1060921
complement(6894)-g, cdbSNP:185966495
complement(6937)-t, cdbSNP:111791349
complement(6984..6985)-, gdbSNP:34214126
complement(7111)-t, cdbSNP:12516
complement(7116)-g, adbSNP:182218567
complement(7147)-t, cdbSNP:189382442
complement(7151)-t, cdbSNP:184237074
complement(7156)-g, adbSNP:8176320
Gene SymbolBRCA1
Gene SynonymBRCAI; BRCC1; BROVCA1; IRIS; PNCA4; PPP1R53; PSCP; RNF53
Chromosome17
Locus Map17q21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_007294 Homo sapiens breast cancer 1, early onset (BRCA1), transcript variant 1, mRNA. On-demand $2699.00 30
NM_007297 Homo sapiens breast cancer 1, early onset (BRCA1), transcript variant 3, mRNA. On-demand $2699.00 30
NM_007298 Homo sapiens breast cancer 1, early onset (BRCA1), transcript variant 4, mRNA. On-demand $849.00 20
NM_007299 Homo sapiens breast cancer 1, early onset (BRCA1), transcript variant 5, mRNA. On-demand $849.00 20
NM_007300 Homo sapiens breast cancer 1, early onset (BRCA1), transcript variant 2, mRNA. On-demand $2699.00 30
Title Emerging roles of BRCA1 alternative splicing .
Author Orban,T.I. and Olah,E.
Journal MP, Mol. Pathol. 56 (4), 191-197 (2003)
Title Expression profiles of BRCA1 splice variants in asynchronous and in G1/S synchronized tumor cell lines .
Author Orban,T.I. and Olah,E.
Journal Biochem. Biophys. Res. Commun. 280 (1), 32-38 (2001)
Title BRCA1: a review of structure and putative functions .
Author Paterson,J.W.
Journal Dis. Markers 13 (4), 261-274 (1998)
Title Mutations and alternative splicing of the BRCA1 gene in UK breast/ovarian cancer families .
Author Xu,C.F., Chambers,J.A., Nicolai,H., Brown,M.A., Hujeirat,Y., Mohammed,S., Hodgson,S., Kelsell,D.P., Spurr,N.K., Bishop,D.T. and Solomon,E.
Journal Genes Chromosomes Cancer 18 (2), 102-110 (1997)
Title Differential subcellular localization, expression and biological toxicity of BRCA1 and the splice variant BRCA1-delta11b .
Author Wilson,C.A., Payton,M.N., Elliott,G.S., Buaas,F.W., Cajulis,E.E., Grosshans,D., Ramos,L., Reese,D.M., Slamon,D.J. and Calzone,F.J.
Journal Oncogene 14 (1), 1-16 (1997)
Title Localization of BRCA1 and a splice variant identifies the nuclear localization signal .
Author Thakur,S., Zhang,H.B., Peng,Y., Le,H., Carroll,B., Ward,T., Yao,J., Farid,L.M., Couch,F.J., Wilson,R.B. and Weber,B.L.
Journal Mol. Cell. Biol. 17 (1), 444-452 (1997)
Title Characterization of functional messenger RNA splice variants of BRCA1 expressed in nonmalignant and tumor-derived breast cells .
Author Lu,M., Conzen,S.D., Cole,C.N. and Arrick,B.A.
Journal Cancer Res. 56 (20), 4578-4581 (1996)
Title Growth retardation and tumour inhibition by BRCA1 .
Author Holt,J.T., Thompson,M.E., Szabo,C., Robinson-Benion,C., Arteaga,C.L., King,M.C. and Jensen,R.A.
Journal Nat. Genet. 12 (3), 298-302 (1996)
Title Distinct transcription start sites generate two forms of BRCA1 mRNA .
Author Xu,C.F., Brown,M.A., Chambers,J.A., Griffiths,B., Nicolai,H. and Solomon,E.
Journal Hum. Mol. Genet. 4 (12), 2259-2264 (1995)
Title A strong candidate for the breast and ovarian cancer susceptibility gene BRCA1 .
Author Miki,Y., Swensen,J., Shattuck-Eidens,D., Futreal,P.A., Harshman,K., Tavtigian,S., Liu,Q., Cochran,C., Bennett,L.M., Ding,W. et al.
Journal Science 266 (5182), 66-71 (1994)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.