• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 4, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_007308 Homo sapiens synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 4, mRNA. GenEZ ORF Cloning In-stock $248.00 $199.00 10

*Business Day

Related Services

RefSeq Version NM_007308.2, 225690600
Length 3127 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 4, mRNA.
Product alpha-synuclein isoform NACP112
Comment

Summary: Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Four alternatively spliced transcripts encoding two different isoforms have been identified for this gene. [provided by RefSeq, Mar 2009].


Transcript Variant: This variant (4, also known as NACP112) lacks an alternate in-frame exon compared to variant 1. The resulting isoform (NACP112) has the same N- and C-termini but is shorter compared to isoform NACP140.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_009292.1
CDS 260..598
Misc Feature(1)242..244
Misc Feature(2)242..244
Misc Feature(3)260..>568
Misc Feature(4)260..>568
Misc Feature(5)518..520
Misc Feature(6)581..583
Exon (1)1..234
Gene:SNCA
Gene Synonym:NACP; PARK1; PARK4; PD1
Exon (2)235..380
Gene:SNCA
Gene Synonym:NACP; PARK1; PARK4; PD1
Exon (3)381..422
Gene:SNCA
Gene Synonym:NACP; PARK1; PARK4; PD1
Exon (4)423..565
Gene:SNCA
Gene Synonym:NACP; PARK1; PARK4; PD1
Exon (5)566..3127
Gene:SNCA
Gene Synonym:NACP; PARK1; PARK4; PD1
Translation MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(7)-dbSNP:
complement(7)-t, gdbSNP:182006507
complement(56)-g, cdbSNP:35064456
complement(180..181)-, adbSNP:201360644
complement(180)-tt, aadbSNP:71594901
complement(180)-t, adbSNP:2245804
complement(181..182)-, adbSNP:200200161
complement(181)-t, adbSNP:2583986
complement(185..186)-, tdbSNP:67845058
complement(187..188)-, adbSNP:3833895
complement(347)-g, cdbSNP:104893878
complement(395)-dbSNP:
complement(395)-g, adbSNP:104893875
complement(406)-t, cdbSNP:141859659
complement(409)-c, adbSNP:201106962
complement(415)-c, adbSNP:148108612
complement(416)-g, adbSNP:104893877
complement(475)-dbSNP:
complement(475)-t, cdbSNP:144758871
complement(484)-t, adbSNP:149401968
complement(557)-g, adbSNP:138969470
complement(583)-dbSNP:
complement(583)-t, cdbSNP:76642636
complement(675)-t, gdbSNP:145304567
complement(714)-g, adbSNP:144511886
complement(715)-t, cdbSNP:184023281
complement(737)-c, adbSNP:10024743
complement(770)-g, adbSNP:192194319
complement(771)-t, cdbSNP:79726680
complement(772)-g, cdbSNP:187958987
complement(792)-t, cdbSNP:34825021
complement(800)-g, adbSNP:185476145
complement(801)-g, adbSNP:35716318
complement(871)-g, adbSNP:193289281
complement(974)-t, cdbSNP:35733299
complement(1062)-t, gdbSNP:183204610
complement(1099)-g, adbSNP:17016074
complement(1191)-c, adbSNP:35101723
complement(1420)-g, adbSNP:35343095
complement(1450)-c, adbSNP:150645039
complement(1491)-g, adbSNP:356165
complement(1492)-t, cdbSNP:192179063
complement(1493)-g, adbSNP:187002185
complement(1519)-t, cdbSNP:148246747
complement(1600)-c, adbSNP:182722435
complement(1692)-, adbSNP:143570143
complement(1822)-t, cdbSNP:147204331
complement(1845)-t, adbSNP:77964369
complement(1872..1875)-, agagdbSNP:141457381
complement(1872)-, gagadbSNP:34094651
complement(1873..1874)-, gadbSNP:71797336
complement(1874..1875)-, agdbSNP:35270750
complement(1874)-g, adbSNP:201351609
complement(1874)-, gadbSNP:5860180
complement(1878)-g, adbSNP:200268319
complement(1891..1892)-g, adbSNP:1987877
complement(1906..1907)-, aaaaadbSNP:33988309
complement(2217)-, adbSNP:35290339
complement(2244)-g, adbSNP:190662034
complement(2275)-g, adbSNP:17016072
complement(2494)-g, adbSNP:186189862
complement(2496..2497)-, ccccccdbSNP:144110885
complement(2703)-t, cdbSNP:3857053
complement(2706)-t, adbSNP:1045722
complement(2828)-t, cdbSNP:183802441
complement(2971)-c, adbSNP:143616400
complement(2972..2973)-, cdbSNP:34094043
Gene SymbolSNCA
Gene SynonymNACP; PARK1; PARK4; PD1
Chromosome4
Locus Map4q21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000345 Homo sapiens synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1, mRNA. In-stock $248.00 $199.00 10
NM_001146054 Homo sapiens synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 2, mRNA. In-stock $248.00 $199.00 10
NM_001146055 Homo sapiens synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 3, mRNA. In-stock $248.00 $199.00 10
NM_007308 Homo sapiens synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 4, mRNA. In-stock $248.00 $199.00 10
Title The secreted oligomeric form of alpha-synuclein affects multiple steps of membrane trafficking .
Author Chai,Y.J., Kim,D., Park,J., Zhao,H., Lee,S.J. and Chang,S.
Journal FEBS Lett. 587 (5), 452-459 (2013)
Title alpha-Synuclein pathology is related to postoperative delirium in patients undergoing gastrectomy .
Author Sunwoo,M.K., Hong,J.Y., Choi,J., Park,H.J., Kim,S.H. and Lee,P.H.
Journal Neurology 80 (9), 810-813 (2013)
Title Mapping the subcellular distribution of alpha-synuclein in neurons using genetically encoded probes for correlated light and electron microscopy: implications for Parkinson's disease pathogenesis .
Author Boassa,D., Berlanga,M.L., Yang,M.A., Terada,M., Hu,J., Bushong,E.A., Hwang,M., Masliah,E., George,J.M. and Ellisman,M.H.
Journal J. Neurosci. 33 (6), 2605-2615 (2013)
Title A progressive dopaminergic phenotype associated with neurotoxic conversion of alpha-synuclein in BAC-transgenic rats .
Author Nuber,S., Harmuth,F., Kohl,Z., Adame,A., Trejo,M., Schonig,K., Zimmermann,F., Bauer,C., Casadei,N., Giel,C., Calaminus,C., Pichler,B.J., Jensen,P.H., Muller,C.P., Amato,D., Kornhuber,J., Teismann,P., Yamakado,H., Takahashi,R., Winkler,J., Masliah,E. and Riess,O.
Journal Brain 136 (PT 2), 412-432 (2013)
Title Alpha-synuclein pathology and axonal degeneration of the peripheral motor nerves innervating pharyngeal muscles in Parkinson disease .
Author Mu,L., Sobotka,S., Chen,J., Su,H., Sanders,I., Adler,C.H., Shill,H.A., Caviness,J.N., Samanta,J.E. and Beach,T.G.
Journal J. Neuropathol. Exp. Neurol. 72 (2), 119-129 (2013)
Title Assignment of human alpha-synuclein (SNCA) and beta-synuclein (SNCB) genes to chromosomes 4q21 and 5q35 .
Author Spillantini,M.G., Divane,A. and Goedert,M.
Journal Genomics 27 (2), 379-381 (1995)
Title The human NACP/alpha-synuclein gene: chromosome assignment to 4q21.3-q22 and TaqI RFLP analysis .
Author Chen,X., de Silva,H.A., Pettenati,M.J., Rao,P.N., St George-Hyslop,P., Roses,A.D., Xia,Y., Horsburgh,K., Ueda,K. and Saitoh,T.
Journal Genomics 26 (2), 425-427 (1995)
Title The NACP/synuclein gene: chromosomal assignment and screening for alterations in Alzheimer disease .
Author Campion,D., Martin,C., Heilig,R., Charbonnier,F., Moreau,V., Flaman,J.M., Petit,J.L., Hannequin,D., Brice,A. and Frebourg,T.
Journal Genomics 26 (2), 254-257 (1995)
Title Tissue-dependent alternative splicing of mRNA for NACP, the precursor of non-A beta component of Alzheimer's disease amyloid .
Author Ueda,K., Saitoh,T. and Mori,H.
Journal Biochem. Biophys. Res. Commun. 205 (2), 1366-1372 (1994)
Title Molecular cloning of cDNA encoding an unrecognized component of amyloid in Alzheimer disease .
Author Ueda,K., Fukushima,H., Masliah,E., Xia,Y., Iwai,A., Yoshimoto,M., Otero,D.A., Kondo,J., Ihara,Y. and Saitoh,T.
Journal Proc. Natl. Acad. Sci. U.S.A. 90 (23), 11282-11286 (1993)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.