• THAT   AND
  • THAT   AND


Homo sapiens TAR DNA binding protein (TARDBP), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_007375 Homo sapiens TAR DNA binding protein (TARDBP), mRNA. Full Lenth $1482.60
ORF Sequence $361.05


RefSeq Version NM_007375.3, 42741653
Length 4236 bp
Structure linear
Update Date 24-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens TAR DNA binding protein (TARDBP), mRNA.
Product TAR DNA-binding protein 43
Comment

Summary: HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. [provided by RefSeq].

RefSeq NP_031401.1
CDS 135..1379
Exon (1)1..122
Exon (2)1..122
Exon (3)123..372
Exon (4)373..536
Exon (5)537..677
Exon (6)678..848
Exon (7)849..4217
Translation MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGI LHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDL KEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNS KQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIA QSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLG NNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQ REPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGFGSSMDSKSSGWGM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
13+a, gdbSNP:11121679
158+c, tdbSNP:72870030
224+g, tdbSNP:111671110
327..328+, tdbSNP:35714982
329+a, tdbSNP:80356716
332+c, tdbSNP:61730366
403+c, tdbSNP:80356715
409+a, cdbSNP:11547736
416+a, gdbSNP:11547735
640+a, gdbSNP:80356717
798+a, cdbSNP:61742415
809+a, gdbSNP:61741294
915+g, tdbSNP:17849488
934+a, gdbSNP:80356718
972+c, tdbSNP:55953904
993+a, c, gdbSNP:80356719
1003+c, gdbSNP:121908395
1015+c, g, tdbSNP:80356721
1017+a, c, gdbSNP:80356723
1026+a, gdbSNP:4884357
1061+g, tdbSNP:117273643
1065+a, gdbSNP:80356725
1077+a, gdbSNP:80356726
1125+a, cdbSNP:80356727
1129+a, gdbSNP:80356728
1138+a, gdbSNP:80356729
1143+a, gdbSNP:80356730
1162+a, gdbSNP:80356731
1169+a, cdbSNP:80356732
1176+g, tdbSNP:80356733
1189+a, gdbSNP:80356734
1217+g, tdbSNP:80356735
1231+c, gdbSNP:80356736
1255..1256+, adbSNP:80356737
1269+c, tdbSNP:80356738
1270+c, gdbSNP:80356739
1278+a, c, gdbSNP:11689432
1281+a, gdbSNP:80356740
1302+a, gdbSNP:80356741
1303+a, gdbSNP:80356742
1312+c, tdbSNP:80356743
1462+c, tdbSNP:80356744
1956+c, tdbSNP:1064824
2386+a, cdbSNP:7545171
2390+a, tdbSNP:7514132
2425+a, tdbSNP:7511713
2485+a, gdbSNP:55829473
complement(2606)-t, cdbSNP:11093
2882+g, tdbSNP:77731284
3672..3673+, tgtttdbSNP:5772439
3673..3674+, gtttt, tgtttdbSNP:3059695
3673..3674+, gttttdbSNP:76924744
3675+a, tdbSNP:114200809
3710+a, gdbSNP:114897688
Gene SymbolTARDBP
Gene SynonymALS10; TDP-43
Chromosome1
Locus Map1p36.22
All Transcripts NM_007375
Title Dysregulation of the ALS-associated gene TDP-43 leads to neuronal death and degeneration in mice .
Author Igaz,L.M., Kwong,L.K., Lee,E.B., Chen-Plotkin,A., Swanson,E., Unger,T., Malunda,J., Xu,Y., Winton,M.J., Trojanowski,J.Q. and Lee,V.M.
Journal J. Clin. Invest. 121 (2), 726-738 (2011)
Title TDP-43 regulates its mRNA levels through a negative feedback loop .
Author Ayala,Y.M., De Conti,L., Avendano-Vazquez,S.E., Dhir,A., Romano,M., D'Ambrogio,A., Tollervey,J., Ule,J., Baralle,M., Buratti,E. and Baralle,F.E.
Journal EMBO J. 30 (2), 277-288 (2011)
Title Does TDP-43 type confer a distinct pattern of atrophy in frontotemporal lobar degeneration? .
Author Whitwell,J.L., Jack,C.R. Jr., Parisi,J.E., Senjem,M.L., Knopman,D.S., Boeve,B.F., Rademakers,R., Baker,M., Petersen,R.C., Dickson,D.W. and Josephs,K.A.
Journal Neurology 75 (24), 2212-2220 (2010)
Title TDP-43 subtypes are associated with distinct atrophy patterns in frontotemporal dementia .
Author Rohrer,J.D., Geser,F., Zhou,J., Gennatas,E.D., Sidhu,M., Trojanowski,J.Q., Dearmond,S.J., Miller,B.L. and Seeley,W.W.
Journal Neurology 75 (24), 2204-2211 (2010)
Title Phosphorylation promotes neurotoxicity in a Caenorhabditis elegans model of TDP-43 proteinopathy .
Author Liachko,N.F., Guthrie,C.R. and Kraemer,B.C.
Journal J. Neurosci. 30 (48), 16208-16219 (2010)
Title Characterization and functional implications of the RNA binding properties of nuclear factor TDP-43, a novel splicing regulator of .
Author Buratti,E. and Baralle,F.E.
Journal J. Biol. Chem. 276 (39), 36337-36343 (2001)
Title Nuclear factor TDP-43 and SR proteins promote in vitro and in vivo .
Author Buratti,E., Dork,T., Zuccato,E., Pagani,F., Romano,M. and Baralle,F.E.
Journal EMBO J. 20 (7), 1774-1784 (2001)
Title Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing .
Author Simpson,J.C., Wellenreuther,R., Poustka,A., Pepperkok,R. and Wiemann,S.
Journal EMBO Rep. 1 (3), 287-292 (2000)
Title Kid, a novel kinesin-like DNA binding protein, is localized to chromosomes and the mitotic spindle .
Author Tokai,N., Fujimoto-Nishiyama,A., Toyoshima,Y., Yonemura,S., Tsukita,S., Inoue,J. and Yamamota,T.
Journal EMBO J. 15 (3), 457-467 (1996)
Title Cloning and characterization of a novel cellular protein, TDP-43, that binds to human immunodeficiency virus type 1 TAR DNA sequence motifs .
Author Ou,S.H., Wu,F., Harrich,D., Garcia-Martinez,L.F. and Gaynor,R.B.
Journal J. Virol. 69 (6), 3584-3596 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878