• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens TAR DNA binding protein (TARDBP), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_007375 Homo sapiens TAR DNA binding protein (TARDBP), mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_007375.3, 42741653
Length 4236 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens TAR DNA binding protein (TARDBP), mRNA.
Product TAR DNA-binding protein 43
Comment

Summary: HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. [provided by RefSeq, Jul 2008].

RefSeq NP_031401.1
CDS 135..1379
Misc Feature(1)129..131
Misc Feature(2)129..131
Misc Feature(3)405..407
Misc Feature(4)405..407
Misc Feature(5)408..410
Misc Feature(6)450..647
Misc Feature(7)order(453..455,573..575,579..581)
Misc Feature(8)603..605
Misc Feature(9)708..>857
Misc Feature(10)order(714..716,819..821,825..827)
Misc Feature(11)1008..1010
Exon (1)1..122
Gene:TARDBP
Gene Synonym:ALS10; TDP-43
Exon (2)123..372
Gene:TARDBP
Gene Synonym:ALS10; TDP-43
Exon (3)373..536
Gene:TARDBP
Gene Synonym:ALS10; TDP-43
Exon (4)537..677
Gene:TARDBP
Gene Synonym:ALS10; TDP-43
Exon (5)678..848
Gene:TARDBP
Gene Synonym:ALS10; TDP-43
Exon (6)849..4217
Gene:TARDBP
Gene Synonym:ALS10; TDP-43
Translation MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGI LHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDL KEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNS KQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIA QSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLG NNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQ REPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGFGSSMDSKSSGWGM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
13+dbSNP:
13+a, gdbSNP:11121679
130+a, gdbSNP:200517396
158+c, tdbSNP:72870030
164+c, tdbSNP:140008847
221+c, tdbSNP:201693535
224+g, tdbSNP:111671110
327..328+, tdbSNP:35714982
329+a, tdbSNP:80356716
332+c, tdbSNP:61730366
361+a, gdbSNP:142913423
403+dbSNP:
403+c, tdbSNP:80356715
409+a, cdbSNP:11547736
416+a, gdbSNP:11547735
464+g, tdbSNP:199804130
535+a, gdbSNP:201738296
640+dbSNP:
640+a, gdbSNP:80356717
704+dbSNP:
704+c, tdbSNP:147772554
766+c, tdbSNP:199933965
776+c, tdbSNP:138201492
798+a, cdbSNP:61742415
803+c, gdbSNP:149517613
809+a, gdbSNP:61741294
915+dbSNP:
915+g, tdbSNP:17849488
921+a, gdbSNP:267607102
934+a, gdbSNP:80356718
972+c, tdbSNP:55953904
993+a, c, gdbSNP:80356719
1003+c, gdbSNP:121908395
1006+a, gdbSNP:140046109
1015+c, g, tdbSNP:80356721
1017+a, c, gdbSNP:80356723
1026+a, gdbSNP:4884357
1034+a, gdbSNP:146402671
1061+g, tdbSNP:193107117
1065+a, gdbSNP:80356725
1075+c, gdbSNP:150052883
1077+a, gdbSNP:80356726
1079+a, gdbSNP:145364830
1125+a, cdbSNP:80356727
1129+a, gdbSNP:80356728
1138+a, gdbSNP:80356729
1143+a, gdbSNP:80356730
1162+a, gdbSNP:80356731
1169+a, cdbSNP:80356732
1176+g, tdbSNP:80356733
1189+a, gdbSNP:80356734
1217+g, tdbSNP:80356735
1231+c, gdbSNP:80356736
1232+c, gdbSNP:148325203
1255..1256+, adbSNP:80356737
1256+c, tdbSNP:147795017
1269+c, tdbSNP:80356738
1270+c, gdbSNP:80356739
1278+a, c, gdbSNP:11689432
1281+a, gdbSNP:80356740
1302+a, gdbSNP:80356741
1303+a, gdbSNP:80356742
1312+c, tdbSNP:80356743
1452+c, gdbSNP:185638796
1462+c, tdbSNP:80356744
1587+a, gdbSNP:148414479
1956+c, tdbSNP:1064824
2282+c, tdbSNP:181715581
2386+a, cdbSNP:7545171
2387+g, tdbSNP:141412238
2390+a, tdbSNP:7514132
2425+a, tdbSNP:7511713
2460+c, tdbSNP:184303021
2467+c, gdbSNP:188745732
2547+c, tdbSNP:181172753
2606+c, tdbSNP:11093
2882+g, tdbSNP:202125775
3097+c, gdbSNP:150412704
3233+a, gdbSNP:185335376
3294+c, tdbSNP:188129567
3669..3670+, gttttdbSNP:145446787
3671+c, tdbSNP:199558954
3672..3673+, tgtttdbSNP:5772439
3672+a, tdbSNP:200729007
3673..3674+, gttttdbSNP:200273159
3673..3674+, gtttt, tgtttdbSNP:3059695
3710+a, gdbSNP:114897688
3712+c, tdbSNP:138320721
3713+a, gdbSNP:182302907
4152+a, gdbSNP:187380325
4184+a, tdbSNP:191706916
Gene SymbolTARDBP
Gene SynonymALS10; TDP-43
Chromosome1
Locus Map1p36.22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_007375 Homo sapiens TAR DNA binding protein (TARDBP), mRNA. In-stock $418.00 $369.00 10
Title Parkin ubiquitinates Tar-DNA binding protein-43 (TDP-43) and promotes its cytosolic accumulation via interaction with histone deacetylase 6 (HDAC6) .
Author Hebron,M.L., Lonskaya,I., Sharpe,K., Weerasinghe,P.P., Algarzae,N.K., Shekoyan,A.R. and Moussa,C.E.
Journal J. Biol. Chem. 288 (6), 4103-4115 (2013)
Title Accelerated disease onset with stabilized familial amyotrophic lateral sclerosis (ALS)-linked mutant TDP-43 proteins .
Author Watanabe,S., Kaneko,K. and Yamanaka,K.
Journal J. Biol. Chem. 288 (5), 3641-3654 (2013)
Title Premature death of TDP-43 (A315T) transgenic mice due to gastrointestinal complications prior to development of full neurological symptoms of amyotrophic lateral sclerosis .
Author Esmaeili,M.A., Panahi,M., Yadav,S., Hennings,L. and Kiaei,M.
Journal Int J Exp Pathol 94 (1), 56-64 (2013)
Title Roles of ataxin-2 in pathological cascades mediated by TAR DNA-binding protein 43 (TDP-43) and Fused in Sarcoma (FUS) .
Author Nihei,Y., Ito,D. and Suzuki,N.
Journal J. Biol. Chem. 287 (49), 41310-41323 (2012)
Title TARDBP mutations are not a frequent cause of ALS in Finnish patients .
Author Mentula,H.K., Tuovinen,L., Penttila,S., Suominen,T., Udd,B. and Palmio,J.
Journal Acta Myol 31 (2), 134-138 (2012)
Title Characterization and functional implications of the RNA binding properties of nuclear factor TDP-43, a novel splicing regulator of .
Author Buratti,E. and Baralle,F.E.
Journal J. Biol. Chem. 276 (39), 36337-36343 (2001)
Title Nuclear factor TDP-43 and SR proteins promote in vitro and in vivo .
Author Buratti,E., Dork,T., Zuccato,E., Pagani,F., Romano,M. and Baralle,F.E.
Journal EMBO J. 20 (7), 1774-1784 (2001)
Title Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing .
Author Simpson,J.C., Wellenreuther,R., Poustka,A., Pepperkok,R. and Wiemann,S.
Journal EMBO Rep. 1 (3), 287-292 (2000)
Title Kid, a novel kinesin-like DNA binding protein, is localized to chromosomes and the mitotic spindle .
Author Tokai,N., Fujimoto-Nishiyama,A., Toyoshima,Y., Yonemura,S., Tsukita,S., Inoue,J. and Yamamota,T.
Journal EMBO J. 15 (3), 457-467 (1996)
Title Cloning and characterization of a novel cellular protein, TDP-43, that binds to human immunodeficiency virus type 1 TAR DNA sequence motifs .
Author Ou,S.H., Wu,F., Harrich,D., Garcia-Martinez,L.F. and Gaynor,R.B.
Journal J. Virol. 69 (6), 3584-3596 (1995)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.