• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens TAR DNA binding protein (TARDBP), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_007375 Homo sapiens TAR DNA binding protein (TARDBP), mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_007375.3, 42741653
Length 4236 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens TAR DNA binding protein (TARDBP), mRNA.
Product TAR DNA-binding protein 43
Comment

Summary: HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. [provided by RefSeq, Jul 2008].

RefSeq NP_031401.1
CDS 135..1379
Misc Feature(1)129..131
Misc Feature(2)129..131
Misc Feature(3)405..407
Misc Feature(4)405..407
Misc Feature(5)408..410
Misc Feature(6)447..677
Misc Feature(7)603..605
Misc Feature(8)705..917
Misc Feature(9)order(708..710,714..716,720..725,795..797,813..815,
Misc Feature(10)1008..1010
Exon (1)1..122
Gene:TARDBP
Gene Synonym:ALS10; TDP-43
Exon (2)123..372
Gene:TARDBP
Gene Synonym:ALS10; TDP-43
Exon (3)373..536
Gene:TARDBP
Gene Synonym:ALS10; TDP-43
Exon (4)537..677
Gene:TARDBP
Gene Synonym:ALS10; TDP-43
Exon (5)678..848
Gene:TARDBP
Gene Synonym:ALS10; TDP-43
Exon (6)849..4217
Gene:TARDBP
Gene Synonym:ALS10; TDP-43
Translation MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGI LHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDL KEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNS KQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIA QSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLG NNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQ REPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGFGSSMDSKSSGWGM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
13+dbSNP:
13+a, gdbSNP:11121679
130+a, gdbSNP:200517396
158+c, tdbSNP:72870030
164+c, tdbSNP:140008847
201+a, gdbSNP:375089732
218+c, tdbSNP:369718876
221+c, tdbSNP:201693535
224+g, tdbSNP:111671110
327..328+, tdbSNP:35714982
329+a, tdbSNP:80356716
332+c, tdbSNP:61730366
361+a, gdbSNP:142913423
403+dbSNP:
403+c, tdbSNP:80356715
407+a, gdbSNP:369009972
409+a, cdbSNP:11547736
416+a, gdbSNP:11547735
445+c, gdbSNP:368273954
464+g, tdbSNP:199804130
470+a, gdbSNP:373324166
535+a, gdbSNP:201738296
640+dbSNP:
640+a, gdbSNP:80356717
704+dbSNP:
704+c, tdbSNP:147772554
734+a, gdbSNP:375128760
766+c, tdbSNP:199933965
776+c, tdbSNP:138201492
798+a, cdbSNP:61742415
803+c, gdbSNP:149517613
809+a, gdbSNP:61741294
complement(915)-dbSNP:
complement(915)-t, gdbSNP:17849488
921+a, gdbSNP:267607102
934+a, gdbSNP:80356718
935+c, tdbSNP:370069646
972+c, tdbSNP:55953904
985+a, gdbSNP:372322441
993+a, c, gdbSNP:80356719
1003+c, gdbSNP:121908395
1006+a, gdbSNP:140046109
1009+c, gdbSNP:376304074
1015+c, g, tdbSNP:80356721
1017+a, c, gdbSNP:80356723
1026+a, gdbSNP:4884357
1034+a, gdbSNP:146402671
1061+g, tdbSNP:193107117
1065+a, gdbSNP:80356725
1075+c, gdbSNP:150052883
1077+a, gdbSNP:80356726
1079+a, gdbSNP:145364830
1092+c, tdbSNP:377713993
1093+c, tdbSNP:267597911
1098+a, gdbSNP:373538082
1125+a, cdbSNP:80356727
1129+a, gdbSNP:80356728
1138+a, gdbSNP:80356729
1143+a, gdbSNP:80356730
1162+a, gdbSNP:80356731
1169+a, cdbSNP:80356732
1176+g, tdbSNP:80356733
1189+a, gdbSNP:80356734
1217+g, tdbSNP:80356735
1231+c, gdbSNP:80356736
1232+c, gdbSNP:148325203
1235+c, tdbSNP:377531374
1255..1256+, adbSNP:80356737
1256+c, tdbSNP:147795017
1269+c, tdbSNP:80356738
1270+c, gdbSNP:80356739
1278+a, c, gdbSNP:367543041
1281+a, gdbSNP:80356740
1302+a, gdbSNP:80356741
1303+a, gdbSNP:80356742
1312+c, tdbSNP:80356743
1423+a, gdbSNP:373319524
1452+c, gdbSNP:185638796
1462+c, tdbSNP:80356744
1587+a, gdbSNP:148414479
1956+c, tdbSNP:1064824
2000+c, tdbSNP:374735544
2076+a, gdbSNP:387906334
2282+c, tdbSNP:181715581
2386+a, cdbSNP:7545171
complement(2387)-t, gdbSNP:141412238
2390+a, tdbSNP:7514132
2425+a, tdbSNP:7511713
2460+c, tdbSNP:184303021
2467+c, gdbSNP:188745732
2547+c, tdbSNP:181172753
complement(2606)-t, cdbSNP:11093
2882+g, tdbSNP:202125775
2882+g, tdbSNP:386456063
3097+c, gdbSNP:150412704
3163+a, gdbSNP:367730821
3233+a, gdbSNP:185335376
3240+a, gdbSNP:373070606
3294+c, tdbSNP:188129567
3669..3670+, gttttdbSNP:145446787
3671+c, tdbSNP:199558954
3672..3673+, tgtttdbSNP:5772439
3672+a, tdbSNP:200729007
3673..3674+, gtttt, tgtttdbSNP:3059695
3710+a, gdbSNP:114897688
3712+c, tdbSNP:138320721
3713+a, gdbSNP:182302907
4053+g, tdbSNP:370008350
4152+a, gdbSNP:187380325
4184+a, tdbSNP:191706916
Gene SymbolTARDBP
Gene SynonymALS10; TDP-43
Chromosome1
Locus Map1p36.22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_007375 Homo sapiens TAR DNA binding protein (TARDBP), mRNA. In-stock $418.00 $369.00 10
Title Reduced cellular Ca(2+) availability enhances TDP-43 cleavage by apoptotic caspases .
Author De Marco G, Lomartire A, Mandili G, Lupino E, Buccinna B, Ramondetti C, Moglia C, Novelli F, Piccinini M, Mostert M, Rinaudo MT, Chio A and Calvo A.
Journal Biochim. Biophys. Acta 1843 (4), 725-734 (2014)
Title 'Structural characterization of the minimal segment of TDP-43 competent for aggregation' .
Author Mompean M, Buratti E, Guarnaccia C, Brito RM, Chakrabartty A, Baralle FE and Laurents DV.
Journal Arch. Biochem. Biophys. 545, 53-62 (2014)
Title Axonal transport of TDP-43 mRNA granules is impaired by ALS-causing mutations .
Author Alami NH, Smith RB, Carrasco MA, Williams LA, Winborn CS, Han SS, Kiskinis E, Winborn B, Freibaum BD, Kanagaraj A, Clare AJ, Badders NM, Bilican B, Chaum E, Chandran S, Shaw CE, Eggan KC, Maniatis T and Taylor JP.
Journal Neuron 81 (3), 536-543 (2014)
Title TDP-43 in ALS: stay on target...almost there .
Author Jovicic A and Gitler AD.
Journal Neuron 81 (3), 463-465 (2014)
Title Nuclear factor TDP-43 and SR proteins promote in vitro and in vivo .
Author Buratti E, Dork T, Zuccato E, Pagani F, Romano M and Baralle FE.
Journal EMBO J. 20 (7), 1774-1784 (2001)
Title Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing .
Author Simpson JC, Wellenreuther R, Poustka A, Pepperkok R and Wiemann S.
Journal EMBO Rep. 1 (3), 287-292 (2000)
Title Kid, a novel kinesin-like DNA binding protein, is localized to chromosomes and the mitotic spindle .
Author Tokai N, Fujimoto-Nishiyama A, Toyoshima Y, Yonemura S, Tsukita S, Inoue J and Yamamota T.
Journal EMBO J. 15 (3), 457-467 (1996)
Title Cloning and characterization of a novel cellular protein, TDP-43, that binds to human immunodeficiency virus type 1 TAR DNA sequence motifs .
Author Ou SH, Wu F, Harrich D, Garcia-Martinez LF and Gaynor RB.
Journal J. Virol. 69 (6), 3584-3596 (1995)
Title TARDBP-Related Amyotrophic Lateral Sclerosis .
Author Harms,M.M., Miller,T.M. and Baloh,R.H.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Amyotrophic Lateral Sclerosis Overview .
Author Kinsley,L. and Siddique,T.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.