|
You are here:
Biology CRO for Drug Discovery » Molecular Biology Services » Custom ORF Cloning Services » ORF Detail
 |
Mus musculus cortistatin (Cort), mRNA.
| RefSeq Version | NM_007745.3, 142376224 |
| Length | 498 bp |
| Structure | linear |
| Update Date | 11-MAR-2011 |
| Organism | Mus musculus (house mouse) |
| Definition | Mus musculus cortistatin (Cort), mRNA. |
| Product | cortistatin precursor |
| Comment | COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AK013496.1. On Apr 6, 2007 this sequence version replaced gi:31982453. Sequence Note: removed 2 bases from the 5' end that did not align to the reference genome assembly. |
| RefSeq | NP_031771.1 |
| CDS | 96..425 | Exon (1) | 1..215 | Exon (2) | 1..215 | Exon (3) | 216..498 |
| Translation | MMGGRGTGGKWPSAFGLLLLWGVAASALPLESGPTGQDSVQEATEGRSGLLTFLAWWHEW
ASQASSSTPVGGGTPGLSKSQERPPPQQPPHLDKKPCKNFFWKTFSSCK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(63) | - | t, c | dbSNP:32581765 |
| complement(269) | - | g, c | dbSNP:32581817 |
| complement(302) | - | t, g | dbSNP:46253096 |
| Title | A high-resolution anatomical atlas of the transcriptome in the mouse embryo . |
| Author | Diez-Roux,G., Banfi,S., Sultan,M., Geffers,L., Anand,S., Rozado,D., Magen,A., Canidio,E., Pagani,M., Peluso,I., Lin-Marq,N., Koch,M., Bilio,M., Cantiello,I., Verde,R., De Masi,C., Bianchi,S.A., Cicchini,J., Perroud,E., Mehmeti,S., Dagand,E., Schrinner,S., Nurnberger,A., Schmidt,K., Metz,K., Zwingmann,C., Brieske,N., Springer,C., Hernandez,A.M., Herzog,S., Grabbe,F., Sieverding,C., Fischer,B., Schrader,K., Brockmeyer,M., Dettmer,S., Helbig,C., Alunni,V., Battaini,M.A., Mura,C., Henrichsen,C.N., Garcia-Lopez,R., Echevarria,D., Puelles,E., Garcia-Calero,E., Kruse,S., Uhr,M., Kauck,C., Feng,G., Milyaev,N., Ong,C.K., Kumar,L., Lam,M., Semple,C.A., Gyenesei,A., Mundlos,S., Radelof,U., Lehrach,H., Sarmientos,P., Reymond,A., Davidson,D.R., Dolle,P., Antonarakis,S.E., Yaspo,M.L., Martinez,S., Baldock,R.A., Eichele,G. and Ballabio,A. |
| Journal | PLoS Biol. 9 (1), E1000582 (2011) |
| Title | Null mutant mouse models of somatostatin and cortistatin, and their receptors . |
| Author | Zeyda,T. and Hochgeschwender,U. |
| Journal | Mol. Cell. Endocrinol. 286 (1-2), 18-25 (2008) |
| Title | BGEM: an in situ hybridization database of gene expression in the embryonic and adult mouse nervous system . |
| Author | Magdaleno,S., Jensen,P., Brumwell,C.L., Seal,A., Lehman,K., Asbury,A., Cheung,T., Cornelius,T., Batten,D.M., Eden,C., Norland,S.M., Rice,D.S., Dosooye,N., Shakya,S., Mehta,P. and Curran,T. |
| Journal | PLoS Biol. 4 (4), E86 (2006) |
| Title | Overexpression of the human beta-amyloid precursor protein downregulates cortistatin mRNA in PDAPP mice . |
| Author | Winsky-Sommerer,R., Spier,A.D., Fabre,V., de Lecea,L. and Criado,J.R. |
| Journal | Brain Res. 1023 (1), 157-162 (2004) |
| Title | Polygenic expression of somatostatin in the sturgeon Acipenser transmontanus: molecular cloning and distribution of the mRNAs encoding two somatostatin precursors . |
| Author | Trabucchi,M., Tostivint,H., Lihrmann,I., Sollars,C., Vallarino,M., Dores,R.M. and Vaudry,H. |
| Journal | J. Comp. Neurol. 443 (4), 332-345 (2002) |
| Title | Cortistatin and somatostatin mRNAs are differentially regulated in response to kainate . |
| Author | Calbet,M., Guadano-Ferraz,A., Spier,A.D., Maj,M., Sutcliffe,J.G., Przewlocki,R. and de Lecea,L. |
| Journal | Brain Res. Mol. Brain Res. 72 (1), 55-64 (1999) |
| Title | Cloning, mRNA expression, and chromosomal mapping of mouse and human preprocortistatin . |
| Author | de Lecea,L., Ruiz-Lozano,P., Danielson,P.E., Peelle-Kirley,J., Foye,P.E., Frankel,W.N. and Sutcliffe,J.G. |
| Journal | Genomics 42 (3), 499-506 (1997) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |