Mus musculus pro-opiomelanocortin-alpha (Pomc), mRNA.
| RefSeq Version | NM_008895.3, 142346465 |
| Length | 1007 bp |
| Structure | linear |
| Update Date | 01-MAY-2011 |
| Organism | Mus musculus (house mouse) |
| Definition | Mus musculus pro-opiomelanocortin-alpha (Pomc), mRNA. |
| Product | pro-opiomelanocortin |
| Comment | COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AK017492.1. On Apr 6, 2007 this sequence version replaced gi:31982108. Sequence Note: removed 2 bases from the 5' end that did not align to the reference genome assembly. |
| RefSeq | NP_032921.1 |
| CDS | 150..857 | Exon (1) | 1..96 | Exon (2) | 1..96 | Exon (3) | 97..281 | Exon (4) | 282..1007 |
| Translation | MPRFCYSRSGALLLALLLQTSIDVWSWCLESSQCQDLTTESNLLACIRACKLDLSLETPV
FPGNGDEQPLTENPRKYVMGHFRWDRFGPRNSSSAGSAAQRRAEEEAVWGDGSPEPSPRE
GKRSYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEFKRELEGERPLGLEQVLES
DAEKDDGPYRVEHFRWSNPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 469 | + | c, t | dbSNP:4229222 |
| 489 | + | c, t | dbSNP:48278929 |
| 566 | + | a, g | dbSNP:4229223 |
| 695 | + | c, g | dbSNP:4229224 |
| 752 | + | a, g | dbSNP:4229225 |
| 782 | + | c, g | dbSNP:52030186 |
| 877 | + | c, t | dbSNP:47399157 |
| 907 | + | c, t | dbSNP:50687746 |
| Gene Symbol | Pomc |
| Gene Synonym | ACTH; alpha-MSH; alphaMSH; BE; beta-MSH; gamma-MSH; Pomc-1; Pomc1 |
| Chromosome | 12 |
| Locus Map | 12 4.0 cM |
| All Transcripts | NM_008895 |
| Title | Spatial and temporal localization of the melanocortin 1 receptor and its ligand alpha-melanocyte-stimulating hormone during cutaneous wound repair . |
| Author | Muffley,L.A., Zhu,K.Q., Engrav,L.H., Gibran,N.S. and Hocking,A.M. |
| Journal | J. Histochem. Cytochem. 59 (3), 278-288 (2011) |
| Title | Lack of the ventral anterior homeodomain transcription factor VAX1 leads to induction of a second pituitary . |
| Author | Bharti,K., Gasper,M., Bertuzzi,S. and Arnheiter,H. |
| Journal | Development 138 (5), 873-878 (2011) |
| Title | Differential requirements for neurogenin 3 in the development of . |
| Author | Pelling,M., Anthwal,N., McNay,D., Gradwohl,G., Leiter,A.B., Guillemot,F. and Ang,S.L. |
| Journal | Dev. Biol. 349 (2), 406-416 (2011) |
| Title | Numb deletion in POMC-expressing cells impairs pituitary intermediate lobe cell adhesion, progenitor cell localization, and neuro-intermediate lobe boundary formation . |
| Author | Moran,T.B., Goldberg,L.B., Serviss,S.L. and Raetzman,L.T. |
| Journal | Mol. Endocrinol. 25 (1), 117-127 (2011) |
| Title | A high-resolution anatomical atlas of the transcriptome in the mouse embryo . |
| Author | Diez-Roux,G., Banfi,S., Sultan,M., Geffers,L., Anand,S., Rozado,D., Magen,A., Canidio,E., Pagani,M., Peluso,I., Lin-Marq,N., Koch,M., Bilio,M., Cantiello,I., Verde,R., De Masi,C., Bianchi,S.A., Cicchini,J., Perroud,E., Mehmeti,S., Dagand,E., Schrinner,S., Nurnberger,A., Schmidt,K., Metz,K., Zwingmann,C., Brieske,N., Springer,C., Hernandez,A.M., Herzog,S., Grabbe,F., Sieverding,C., Fischer,B., Schrader,K., Brockmeyer,M., Dettmer,S., Helbig,C., Alunni,V., Battaini,M.A., Mura,C., Henrichsen,C.N., Garcia-Lopez,R., Echevarria,D., Puelles,E., Garcia-Calero,E., Kruse,S., Uhr,M., Kauck,C., Feng,G., Milyaev,N., Ong,C.K., Kumar,L., Lam,M., Semple,C.A., Gyenesei,A., Mundlos,S., Radelof,U., Lehrach,H., Sarmientos,P., Reymond,A., Davidson,D.R., Dolle,P., Antonarakis,S.E., Yaspo,M.L., Martinez,S., Baldock,R.A., Eichele,G. and Ballabio,A. |
| Journal | PLoS Biol. 9 (1), E1000582 (2011) |
| Title | Altered estrogenic modulation of hypothalamic proopiomelanocortin gene expression in aging mice . |
| Author | Nelson,J.F. and Karelus,K. |
| Journal | Ann. N. Y. Acad. Sci. 663, 501-504 (1992) |
| Title | Identification of DNA elements cooperatively activating proopiomelanocortin gene expression in the pituitary glands of transgenic mice . |
| Author | Liu,B., Hammer,G.D., Rubinstein,M., Mortrud,M. and Low,M.J. |
| Journal | Mol. Cell. Biol. 12 (9), 3978-3990 (1992) |
| Title | Adrenocorticotropic cell distribution in adult and embryonic pituitaries of the little (lit) mutant mouse . |
| Author | Wilson,D.B. and Wyatt,D.P. |
| Journal | Anat. Embryol. 186 (4), 347-353 (1992) |
| Title | Aging impairs estrogenic suppression of hypothalamic proopiomelanocortin messenger ribonucleic acid in the mouse . |
| Author | Karelus,K. and Nelson,J.F. |
| Journal | Neuroendocrinology 55 (6), 627-633 (1992) |
| Title | Corticotropin and beta-endorphin: construction and analysis of recombinant DNA complementary to mRNA for the common precursor . |
| Author | Roberts,J.L., Seeburg,P.H., Shine,J., Herbert,E., Baxter,J.D. and Goodman,H.M. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 76 (5), 2153-2157 (1979) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |