|
You are here:
Biology CRO for Drug Discovery » Molecular Biology Services » Custom ORF Cloning Services » ORF Detail
 |
Mus musculus secretogranin II (Scg2), mRNA.
| RefSeq Version | NM_009129.2, 71361680 |
| Length | 2485 bp |
| Structure | linear |
| Update Date | 17-APR-2011 |
| Organism | Mus musculus (house mouse) |
| Definition | Mus musculus secretogranin II (Scg2), mRNA. |
| Product | secretogranin-2 precursor |
| Comment | COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CK619591.1, BI735349.1, BC014717.1 and BE863515.1. On Jul 28, 2005 this sequence version replaced gi:6677864. |
| RefSeq | NP_033155.1 |
| CDS | 150..2003 | Exon (1) | 1..135 | Exon (2) | 1..135 | Exon (3) | 136..2485 |
| Translation | MAGAKAYRLGAVLLLIHLIFLISGAEAASFQRNQLLQKEPDLRLENVQKFPSPEMIRALE
YIEKLRQQAHREESSPDYNPYQGVSVPLQLKENGEESHLAESSRDALSEDEWMRIILEAL
RQAENEPPSAPKENKPYALNLEKNFPVDTPDDYETQQWPERKLKHMRFPLMYEENSRENP
FKRTNEIVEEQYTPQSLATLESVFQELGKLTGPSNQKRERVDEEQKLYTDDEDDVYKTNN
IAYEDVVGGEDWSPIEEKIETQTQEEVRDSKENTEKNEQINEEMKRSGQLGLPDEENRRE
SKDQLSEDASKVITYLRRLVNAVGSGRSQSGPNGDRAARLLQKPLDSQSIYQLIEISRNL
QIPPEDLIEMLKAGEKPNGLVEPEQDLELAVDLDDIPEADLDRPDMFQSKMLSKGGYPKA
PGRGMVEALPDGLSVEDILNVLGMENVVNQKSPYFPNQYSQDKALMRLPYGPGKSRANQI
PKVAWIPDVESRQAPYENLNDQELGEYLARMLVKYPELLNTNQLKRVPSPVSSEDDLQEE
EQLEQAIKEHLGPGSSQEMERLAKVSKRIPVGSLKNEDTPNRQYLDEDMLLKVLEYLNQE
QAEQGREHLAKRAMENM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(278) | - | t, a | dbSNP:30156253 |
| complement(447) | - | t, c | dbSNP:30157154 |
| complement(554) | - | c, a | dbSNP:8253466 |
| complement(587) | - | t, g | dbSNP:30157155 |
| complement(671) | - | t, c | dbSNP:30157156 |
| complement(833) | - | g, a | dbSNP:8253468 |
| complement(1013) | - | t, c | dbSNP:8253467 |
| complement(1161) | - | t, c | dbSNP:4222479 |
| complement(1357) | - | t, c | dbSNP:8253469 |
| complement(1418) | - | g, a | dbSNP:4222478 |
| 1538 | + | a, g | dbSNP:8253470 |
| 1807 | + | a, c | dbSNP:8253473 |
| 1943 | + | c, t | dbSNP:8253474 |
| 1949 | + | a, g | dbSNP:8253475 |
| complement(1960) | - | t, a | dbSNP:13475299 |
| 2048 | + | c, t | dbSNP:8253476 |
| 2171 | + | c, t | dbSNP:8253471 |
| 2292 | + | c, t | dbSNP:8253472 |
| Title | Cellular expression and subcellular localization of secretogranin . |
| Author | Miyazaki,T., Yamasaki,M., Uchigashima,M., Matsushima,A. and Watanabe,M. |
| Journal | Eur. J. Neurosci. 33 (1), 82-94 (2011) |
| Title | Aspects of the neuroendocrine cerebellum: expression of secretogranin II, chromogranin A and chromogranin B in mouse cerebellar unipolar brush cells . |
| Author | Nunzi,M.G. and Mugnaini,E. |
| Journal | Neuroscience 162 (3), 673-687 (2009) |
| Title | Secretogranin II binds to secretogranin III and forms secretory granules with orexin, neuropeptide Y, and POMC . |
| Author | Hotta,K., Hosaka,M., Tanabe,A. and Takeuchi,T. |
| Journal | J. Endocrinol. 202 (1), 111-121 (2009) |
| Title | Identification of transcripts with enriched expression in the developing and adult pancreas . |
| Author | Hoffman,B.G., Zavaglia,B., Witzsche,J., Ruiz de Algara,T., Beach,M., Hoodless,P.A., Jones,S.J., Marra,M.A. and Helgason,C.D. |
| Journal | Genome Biol. 9 (6), R99 (2008) |
| Title | Lmx1b is required for maintenance of central serotonergic neurons and mice lacking central serotonergic system exhibit normal locomotor activity . |
| Author | Zhao,Z.Q., Scott,M., Chiechio,S., Wang,J.S., Renner,K.J., Gereau,R.W. IV, Johnson,R.L., Deneris,E.S. and Chen,Z.F. |
| Journal | J. Neurosci. 26 (49), 12781-12788 (2006) |
| Title | Formation and sequence analysis of secretoneurin, a neuropeptide derived from secretogranin II, in mammalian, bird, reptile, amphibian and fish brains . |
| Author | Leitner,B., Schneitler,C., Klocker,H., Volknandt,W., Zimmermann,H., Winkler,H. and Fischer-Colbrie,R. |
| Journal | Neurosci. Lett. 248 (2), 105-108 (1998) |
| Title | Cloning, chromosomal mapping and expression pattern of the mouse Brca2 gene . |
| Author | Connor,F., Smith,A., Wooster,R., Stratton,M., Dixon,A., Campbell,E., Tait,T.M., Freeman,T. and Ashworth,A. |
| Journal | Hum. Mol. Genet. 6 (2), 291-300 (1997) |
| Title | Dispersion of chromogranin/secretogranin secretory protein family loci in mammalian genomes . |
| Author | Mahata,S.K., Kozak,C.A., Szpirer,J., Szpirer,C., Modi,W.S., Gerdes,H.H., Huttner,W.B. and O'Connor,D.T. |
| Journal | Genomics 33 (1), 135-139 (1996) |
| Title | The organisation of the mouse secretogranin II gene . |
| Author | Schimmel,A., Braunling,O., Ruther,U., Huttner,W.B. and Gerdes,H.H. |
| Journal | FEBS Lett. 314 (3), 375-380 (1992) |
| Title | A nomenclature proposal for the chromogranin/secretogranin proteins . |
| Author | Eiden,L.E., Huttner,W.B., Mallet,J., O'Connor,D.T., Winkler,H. and Zanini,A. |
| Journal | Neuroscience 21 (3), 1019-1021 (1987) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |